KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0286621
Entry
DDB_G0286621      CDS       T00245                                 

Gene name
BRIP1
Definition
(RefSeq) DEAD/DEAH box helicase
  KO
K15362  fanconi anemia group J protein [EC:3.6.4.12]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0286621 (BRIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0286621 (BRIP1)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DDB_G0286621 (BRIP1)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-B complex
     DDB_G0286621 (BRIP1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     DDB_G0286621 (BRIP1)
SSDB
Motif
Pfam: Helicase_C_2 DEAD_2 DEAD Kinesin_assoc ResIII
Other DBs
NCBI-GeneID: 8625714
NCBI-ProteinID: XP_637574
dictyBase: DDB_G0286621
UniProt: Q54LI7
Position
4
AA seq 1078 aa
MSSNNNNPPPKKVFSLSLLKPSPRVSGSSLPSSQSSQSSQSSQHSQSSQPPPSILSFFKA
KPITSSSQSSQTPATTTTTTTTTTTTTKTSTTIGVKRPISDIMDSGDDFNYLENEPDDYY
NTPFDYFNNSNINNNNNINNNNNNSVNKNTNTNSNINTNINGSIINNNNNKINVKDDASY
EKYEELGNGVYKIGNYKVKFPFKPYACQASMMSRILEGLDSKENCILESPTGTGKTLSLL
CSSLAWQEENKKKNQRDLEEKRKLALDSKQRMIEKKQLIDAAAAASAASNTTSNLPSITS
TSTSNSTSTSTSTSPIKQEATATTATTNSISPIKQETTKTTTTMTTTPSTSPIKSEELNL
DSYKYEKGLQCDYNGTGVGKFEPKKIPKIINKKPKYGSMTTTTTIQNNELIDYDNDGTQK
FIKKKSPTIFFCSRTHSQIKQLTGELKKTPYRPNMVVLASRDQYCINPLLKDVPKKLEKC
KKLLLDHGCRFKKTEQQTSLAKSSDFLGGGKKEVWDIEDLMEAGQAHSECPYFASRDMIE
KADLIFCPYNYLIDPQIRKSFADKVAGSIVIFDEAHNIEDALMETSSFDSSLEELNEHCY
QNFKDCIMNSRTMSMLSNEKALAIHYCYKLLESIIAWINKKVQTLKPIDFEKHQNVWKGE
KILNIFEEFGLNETNYFSFRDHLATLFDEGDGTSDNGKEGGGGSLSFPSKGKGGIGVGSN
KQKIDPVPQRALVLLESFEKVTAMIYQNKGWIEDYRLVLQKASAFQTNGGKKSNQGTKWN
YQFGIWAMSPRIAFSSLVQATRSVVLTSGTLSPLYSFPMELAAKFPISAEMGNLPDIAQR
AWIGTLSHGVKGTKLICTHGPSEGLDFQDSLGETILQHIELIPSGVLCFFPSYGFLEKLL
SRWDETGILKKINAKKRYFYEPKNQREFIETLDNYREEIKQRPNKGAILFAVCRGKVSEG
IDFSDEYARGVIVVGIPYPSLVDLRIVLKKEHNDTNKKGISGGDWYKLQAYRALNQALGR
CIRHKNDYGSILLIDERFTQMGNWNSLSKWTRSCIKNNRNLNTSLSSLKLFYDSKNKQ
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgagtagtaataataataatccaccaccaaaaaaagtgttttcgcttagtttgttaaaa
ccttctcctagagttagtggatcatcattaccttcatcacaatcatcacaatcttcacaa
tcatcacaacattcacaatcatcacaaccgccaccatcaattctttcatttttcaaagca
aaaccaattacatcttcatcacaatcgtcacaaacaccagcaaccactacaacaaccact
acaacaacaacaacaacaacaaaaacatcaactacaatcggagtaaaaagaccaatatcg
gatattatggatagtggagatgatttcaattatttagagaatgaacctgatgattactat
aatacaccattcgattattttaataattcaaatataaataataataataatataaataat
aataacaataatagtgtaaataaaaatacaaatactaatagtaatattaataccaatata
aatggaagtattattaataataataataataaaattaatgttaaagatgatgcttcatat
gaaaaatatgaagaattaggaaatggtgtatacaaaattggtaattataaagttaaattc
ccattcaaaccatatgcatgtcaagcatcaatgatgtctagaattttagaaggtttagat
agtaaagagaattgtatattagaatcaccaactggcactggtaaaactttatctctacta
tgttcatcattagcatggcaagaagaaaataaaaaaaaaaatcaaagagatttagaagaa
aaaagaaaattagctttagattcaaaacaaagaatgattgaaaaaaagcaattaattgat
gctgccgctgctgcttctgctgcttccaatactacttcaaatttaccatctataacttca
acttcaacttctaattcaacttcaacttcaacttccacgtcaccaataaaacaagaagca
actgcaaccacagctacaacaaattcaatttcaccaataaaacaagagacaacaaaaaca
acaacaacaatgacaacgacaccatcaacatcaccaattaaaagtgaagaattaaattta
gattcatataaatatgaaaaaggtttacaatgtgattataatggtacaggagttggtaaa
tttgaaccaaagaaaataccaaaaataataaataaaaaaccaaaatatggatcaatgaca
accacaacgacaatacaaaataatgaattaattgattatgataatgatggtacacaaaaa
tttataaaaaagaaatctccaactatattcttttgttcaagaactcattcacaaattaaa
caattaacaggtgaattaaaaaagacaccctatagaccaaatatggttgtattagcatca
cgtgatcaatattgtattaatccattattaaaggatgtaccaaagaaacttgaaaaatgt
aaaaaactattattagatcatggttgtcgttttaaaaaaactgaacaacaaacatcattg
gcaaaatcatcagactttttagggggtggtaaaaaagaagtttgggatattgaagattta
atggaagcaggtcaagcacacagtgaatgtccttatttcgcatcaagagatatgattgaa
aaagcagatttaatattttgtccttataattacttaattgatccacaaatccgaaaaagt
tttgcagataaagttgcaggttcaattgtaatctttgatgaagctcataatattgaagat
gccttaatggagacgagtagtttcgattcatcattagaggaattgaatgaacattgttat
cagaattttaaagattgtataatgaattcaagaactatgagtatgctatccaatgaaaaa
gcattagccattcattattgttataaactattggaatcaattatcgcttggattaataaa
aaagttcaaactttaaaaccaatagattttgaaaaacatcaaaacgtttggaaaggtgaa
aagattttaaatatttttgaagagtttggtttaaatgaaacaaattatttcagctttcgt
gatcatcttgcaacattatttgatgaaggtgatggtacttctgataatggtaaagaaggt
ggtggtggttcactttcatttccatcaaaaggtaaaggtggtattggtgttggtagtaat
aaacaaaaaattgatccagtaccacaaagagcattagtattattagaatcatttgaaaaa
gttacagcaatgatttatcaaaacaaaggttggattgaagattatagattggttttacaa
aaagcatcagcatttcaaacaaatggtggtaagaaaagtaatcaaggtacaaaatggaat
tatcaatttggtatttgggcaatgagtccaagaattgcattttcatcattggttcaagca
actcgttctgttgtattaacatctggtacattatcaccattgtattcatttccaatggaa
ttggcagcgaaattcccaatttcagcagagatgggtaatttaccagatattgcacaacgt
gcttggattggtacattatcacatggagtaaagggtacaaaattaatttgtacacatggt
ccatcagagggattagattttcaagattcattaggtgaaactattttacaacatatcgaa
ttaataccgagcggtgtactttgtttctttccttcgtatggatttttagagaaattgtta
agtcgttgggatgaaactggtattctaaagaaaatcaatgcaaagaagagatatttttat
gaaccaaagaatcaaagagaattcattgaaaccctagataattatcgtgaagaaattaaa
caacgtccaaataaaggtgcaatcttattcgcagtttgtcgtggtaaagttagcgaaggt
attgatttcagtgatgaatatgctagaggtgttatagtcgttggtatcccctatccatct
ttagtagatcttcgtatcgttttaaagaaagaacataacgatacaaataaaaaaggtata
agtggtggcgattggtataaattacaagcttatcgtgccttaaatcaagctctaggtaga
tgtattagacacaaaaatgattatggttccattttattaatagatgaaagattcacccaa
atgggtaattggaattcactttcaaaatggacacgttcatgtataaaaaataatagaaat
ttaaatacctcactttcatctttaaaattattttatgattcaaaaaataaacaataa

DBGET integrated database retrieval system