KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287607
Entry
DDB_G0287607      CDS       T00245                                 

Gene name
pcna
Definition
(RefSeq) proliferating cell nuclear antigen
  KO
K04802  proliferating cell nuclear antigen
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03030  DNA replication
ddi03410  Base excision repair
ddi03420  Nucleotide excision repair
ddi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    DDB_G0287607 (pcna)
   03410 Base excision repair
    DDB_G0287607 (pcna)
   03420 Nucleotide excision repair
    DDB_G0287607 (pcna)
   03430 Mismatch repair
    DDB_G0287607 (pcna)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0287607 (pcna)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0287607 (pcna)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    DDB_G0287607 (pcna)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DDB_G0287607 (pcna)
   MMR (mismatch excision repair)
    Other MMR factors
     DDB_G0287607 (pcna)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    DDB_G0287607 (pcna)
SSDB
Motif
Pfam: PCNA_N PCNA_C Rad9 Myco_19_kDa
Other DBs
NCBI-GeneID: 8626212
NCBI-ProteinID: XP_637117
dictyBase: DDB_G0287607
UniProt: Q54K47
Position
5
AA seq 258 aa
MFEARLLQASLLKKILESIKDLVESANFDCSPEGISLQAMDGTHVTLINLVLRNEGFETY
NCDRSLSLGLSLVSLSKILKCAGNDDTLTIRARDNESDTVTFVFESPKNDRVSDFEIKLI
DIKNEQYSIRKSDYSAVIKMPSAELQRICRDLSIIGEIVTISANKEGVKFSVSGDSGSGN
ITIKPTSDSDVPAEQATVIESKEPVVLNFALKFLSNFTKATPLSPMVTLSMSEGIPVVVE
YKIDDLGFLGFFLAPKIE
NT seq 777 nt   +upstreamnt  +downstreamnt
atgtttgaagcccgtttattacaagcatcacttcttaagaagattttagaaagtatcaaa
gatttagtagagtcagccaactttgattgtagtccagaaggtatctcattacaagctatg
gatggtactcatgtcactttaatcaatttagttttacgtaatgaaggttttgaaacttac
aactgtgacagatcattatccctcggtttaagtctagtttcactctcaaagattctcaaa
tgtgctggtaatgatgataccctcaccattagagctcgtgataatgaatctgataccgtt
acttttgttttcgaatcaccaaagaatgatagagttagtgattttgaaattaaattaatc
gatattaagaatgaacaatatagtatccgtaaatcagattactctgcagttattaagatg
ccatcagctgaactccaaagaatttgtagagatctctccatcattggtgaaattgttacc
attagtgccaataaagaaggtgttaaattctctgtttcaggtgattcaggttctggtaac
attaccattaaaccaacctctgactctgatgtcccagccgaacaagctaccgtcattgaa
tcaaaagaaccagtcgtccttaactttgccttaaaattcctttcaaactttaccaaagct
actccactctcaccaatggttactctttcaatgtctgaaggtatcccagttgttgttgaa
tacaaaatagacgatttaggctttttaggattcttccttgcacctaaaattgaataa

DBGET integrated database retrieval system