KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0287633
Entry
DDB_G0287633      CDS       T00245                                 

Name
(RefSeq) DSS1/SEM1 family protein
  KO
K10881  26 proteasome complex subunit DSS1
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03050  Proteasome
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    DDB_G0287633
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0287633
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ddi03019]
    DDB_G0287633
   04131 Membrane trafficking [BR:ddi04131]
    DDB_G0287633
   03051 Proteasome [BR:ddi03051]
    DDB_G0287633
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0287633
Messenger RNA biogenesis [BR:ddi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     DDB_G0287633
Membrane trafficking [BR:ddi04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    DDB_G0287633
Proteasome [BR:ddi03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     DDB_G0287633
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     DDB_G0287633
SSDB
Motif
Pfam: DSS1_SEM1 BIV_Env
Other DBs
NCBI-GeneID: 8626238
NCBI-ProteinID: XP_637143
dictyBase: DDB_G0287633
UniProt: Q54K21
Position
5
AA seq 76 aa
MTKTETKVEPKAEVKPKEDNVEVIEDDEFEEFEDNMAEGEDNSKEQWEDDWDTDKIDDDF
SKQLRAEIESHSTMKS
NT seq 231 nt   +upstreamnt  +downstreamnt
atgacaaaaacagaaactaaagtagaaccaaaagcagaggtcaaaccaaaagaagataat
gtagaagttattgaagatgatgaatttgaagagtttgaagataatatggccgaaggcgaa
gataactcaaaagaacaatgggaagatgattgggatactgataaaattgatgacgatttt
tcaaaacaattaagagctgaaattgaatcccactcaaccatgaaatcataa

DBGET integrated database retrieval system