KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0290297
Entry
DDB_G0290297      CDS       T00245                                 

Gene name
xrcc2
Definition
(RefSeq) AAA ATPase domain-containing protein
  KO
K10879  DNA-repair protein XRCC2
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0290297 (xrcc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0290297 (xrcc2)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     DDB_G0290297 (xrcc2)
SSDB
Motif
Pfam: Rad51 AAA_25 AAA_16 FAM222A Ndc1_Nup RecA PEHE Asparaginase_C AAA_18 DUF4698
Other DBs
NCBI-GeneID: 8627591
NCBI-ProteinID: XP_635785
dictyBase: DDB_G0290297
UniProt: Q54G98
Position
5
AA seq 388 aa
MNSCLKPFDTTGFNVFFKRELKEIKTGIDDIDSFLTEHFKLQTLKREQSLRAIHQQQQQQ
QQQQQQQQQQQQQQPQQPQQPQPQPQPKTHSNQTIQLQPPNLRNHNTGSNNNNNINNVTI
QPYQPINPGVIELYGPSGSGKTEMALEILVNSILPSCEPFKGNEIGVIYFDNDFKFDILK
LEILLQKKYTQCVLKNNNKNNNNTINPSSEEFQQFLKSCLSRLYLIRCKDSFQFLVTLNG
INQFIRNINNNLKNNNNNKNNNNNKSEYPNDISLIIIDSISAFFWIDQKGEPLNVKPNSL
WIEAIKKILNDNIIIVATKQTIFSLNNQNSFNNNNNINNNSAMNIDNGNLSLNQPNINKY
LHIDQHREFLGVEWTKLVKFRKIIKPLK
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaatagttgcttgaaaccatttgatactacaggtttcaatgtatttttcaaaagagaa
ttaaaagaaattaagactggtattgatgatattgatagttttttaacagagcatttcaaa
ttgcaaacattaaaaagggaacaatctttgcgagccatccaccaacaacaacaacaacaa
caacaacaacaacaacaacaacaacaacaacaacaacagcaaccgcagcaaccacagcaa
cctcaacctcaacctcaacctaaaacacattcaaatcaaacgatccaattacaaccacca
aatttaagaaatcataatactggtagtaacaataacaataatataaataatgtaacgata
cagccttatcaaccaattaatccaggtgtaattgaattgtatggacctagtgggtcaggt
aaaacagagatggcattagagatattagtaaattcaatcctaccatcatgtgaacccttt
aaaggaaatgaaattggtgttatatattttgataatgatttcaaatttgatattttaaaa
ttagaaatattattacaaaaaaagtatactcaatgtgttttaaaaaataataataaaaac
aataacaataccataaacccatcatctgaagaatttcaacaatttttgaaatcctgttta
tcaagactttatttaattcgttgtaaagatagttttcaatttttagttacattaaatggt
ataaatcaatttataagaaatattaataataatttaaagaataataataataataaaaat
aataataataataaaagtgaataccctaatgatataagtttaattataattgatagtata
tcagcatttttttggattgaccaaaaaggtgaacctttaaatgttaaaccaaattcacta
tggattgaagcaattaaaaaaatattaaacgataatataattatcgtggctacaaagcaa
acgatcttttctttaaataaccaaaatagttttaataataataataatattaataataac
tcagcaatgaacattgataatgggaatttaagtttaaatcaaccaaatattaataaatat
ttacacatagaccaacatagagaatttttaggtgtagaatggactaaattagtaaaattt
aggaaaataataaagcctttaaaataa

DBGET integrated database retrieval system