KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0291247
Entry
DDB_G0291247      CDS       T00245                                 

Gene name
mfeA
Definition
(RefSeq) hypothetical protein
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi01040  Biosynthesis of unsaturated fatty acids
ddi01100  Metabolic pathways
ddi01212  Fatty acid metabolism
ddi04146  Peroxisome
Module
ddi_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    DDB_G0291247 (mfeA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DDB_G0291247 (mfeA)
Enzymes [BR:ddi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     DDB_G0291247 (mfeA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     DDB_G0291247 (mfeA)
    4.2.1.119  enoyl-CoA hydratase 2
     DDB_G0291247 (mfeA)
SSDB
Motif
Pfam: adh_short adh_short_C2 SCP2 KR Alkyl_sulf_C SCP2_2
Other DBs
NCBI-GeneID: 8628181
NCBI-ProteinID: XP_635235
dictyBase: DDB_G0291247
UniProt: Q9NKW1
Position
6
AA seq 441 aa
MALNFKDKVVIVTGAGGGIGKVYALEFAKRGAKVVVNDLGGSHTGQGSSSKAADKVVEEI
KAAGGTAVANYDSVEDGEKIVQTAMDSFGGVDILINNAGILRDVSFGKMTDGDWDLVYRV
HAKGAYKLSRAAWNHMREKNFGRIIMTSSAAGLYGNFGQANYGSMKMALVGLSNTLAQEG
KSKNIHCNTIAPIAASRLTESVMPPEILEQMKPDYIVPLVLYLCHQDTTETGGVFEVGAG
WVSKVRLQRSAGVYMKDLTPEKIKDNWAQIESFDNPSYPTSASESVSGILAAVNSKPADG
ESVLVRPPKVAVPKALAATPSGSVVVDGYNASKIFTTIQGNIGAKGAELVKKINGIYLIN
IKKGTNTQAWALDLKNGSGSIVVGAGSTKPNVTITVSDEDFVDIMTGKLNAQSAFTKGKL
KISGNMGLATKLGALMQGSKL
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggcattaaattttaaagataaagttgtaattgttacaggtgctggtggtggtattggt
aaagtttatgcattagaatttgctaaacgtggtgctaaagttgttgttaatgatttaggt
ggttcacatacaggtcaaggttcatcatcaaaagcagcagataaagttgttgaagaaatt
aaagcagcaggtggtacagcagttgccaattatgactctgttgaagatggtgaaaagatt
gttcaaaccgctatggattcatttggtggtgtcgatattttaatcaacaatgcaggtatt
ttacgtgacgtcagttttggtaaaatgaccgatggtgattgggatctcgtttatcgtgtc
cacgccaaaggtgcatacaaattatcaagagcagcatggaatcatatgagagagaaaaac
tttggtcgtatcatcatgacaagcagtgccgcaggtctctatggtaactttggtcaagca
aactatggttcaatgaagatggcattggttggtctctccaacacactcgctcaagaaggt
aagagcaagaatatccactgtaacacaattgcaccaattgctgcctctcgtttaaccgaa
tcagtcatgccaccagaaattttggagcaaatgaaaccagactacatcgtaccattggtc
ttgtatctctgccatcaagacaccactgaaactggtggtgttttcgaagttggtgctggt
tgggtcagcaaagttcgtttacaacgttctgctggtgtctatatgaaagacttgacccca
gagaaaatcaaagataattgggcccaaatcgaatcattcgataatccatcctacccaaca
tcagcctctgaaagtgttagtggtatcttggccgctgtcaatagtaaaccagctgatggt
gaatccgttttggttagaccaccaaaggttgctgttccaaaagctcttgctgccactcca
tcaggttctgtcgttgtcgatggttacaatgcttcaaagattttcaccaccattcaaggt
aacattggtgctaaaggtgcagaattagtaaagaaaatcaatggtatctatttaattaac
attaaaaaaggtacaaatacccaagcttgggctttagatttaaagaatggttctggttca
attgttgttggtgctggttcaactaaaccaaacgtaacaatcacagtttcagatgaagat
tttgttgatattatgactggtaaattaaatgctcaatctgctttcaccaaaggtaaatta
aagatttctggtaatatgggtttagctactaaattaggtgcattaatgcaaggttcaaaa
ttataa

DBGET integrated database retrieval system