KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292618
Entry
DDB_G0292618      CDS       T00245                                 

Gene name
ogg1
Definition
(RefSeq) 8-oxoguanine DNA-glycosylase
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DDB_G0292618 (ogg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0292618 (ogg1)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     DDB_G0292618 (ogg1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     DDB_G0292618 (ogg1)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     DDB_G0292618 (ogg1)
SSDB
Motif
Pfam: OGG_N HhH-GPD HHH
Other DBs
NCBI-GeneID: 8628782
NCBI-ProteinID: XP_629527
dictyBase: DDB_G0292618
UniProt: Q54CZ3
Position
6
AA seq 439 aa
MTTTTTNKIPKIKNENDDNNNNNKIPIIKNENDNNNNNNNWEELKLFKNKLDLKKTLFSA
QSFIWKEIVINEIVNEYVGVIGDNIIVLRYKEGSEQDIIEYKFIDSEKRINHDSELMKMQ
DRISTLQNYFYLDLDINQLFKKWRNDEIGNDDNGDKKLHQLNHQFRKSCDKFIGLRLTRQ
NPVDCLFSFICSQNNNVSRITSLVNKLIVGYGSKITDYNHTDYYKFPTLSQLSNATVEEL
NDLGFGYRSKYIVESCKQVIEKGGEQWLNQLKLKPHLEVQKELTTLMGVGKKVADCVSLM
SMDNPNAVAIDTHIYQISKKYLPSLANSSSSLTPKLYQDISNLWESIFGDHAGWAQTILF
ANELSVFKEKSKNIKIKKEINQNNNNNNLKIELKNEKENLKNEKENLKRKIITRSTTSTT
STTTNTINDNLNPKNKKKK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgacaactactactactaataaaattccaaaaataaaaaatgaaaacgatgataataat
aataacaataaaataccaataataaaaaatgaaaatgataataataataataataataat
tgggaagaattaaaattatttaaaaataaattagatttaaaaaaaacattattttcagca
caatcatttatttggaaagaaatagtaataaatgaaatagttaatgaatatgtgggagtt
attggtgataatataattgtgttaagatataaagaaggtagtgaacaagatattattgaa
tataaattcatagattcagagaaacgtataaatcatgatagtgaattaatgaaaatgcaa
gataggatctcaactttacagaattacttttatctagatttagatattaatcaattattt
aaaaaatggagaaacgatgaaattggcaatgatgacaacggtgataagaaacttcatcaa
ttaaaccaccaatttcgaaaaagttgtgataaattcatcggacttcgtctaactagacag
aatccagttgactgtttattcagcttcatttgttcacaaaataataatgtctcaagaatt
acatcacttgtgaataagttaatcgtggggtacggttcgaaaatcacagattacaatcac
acggattattataaatttccaacattgagtcaattgtcaaatgcgacagtagaagaattg
aatgatcttggattcgggtacagatcaaaatacattgttgaatcatgtaaacaagttatt
gaaaaaggtggtgaacaatggttaaatcagttgaaattaaaaccacatttagaggtacaa
aaagagttgacaacattaatgggtgttggtaagaaagtcgctgattgcgtatcactaatg
tcaatggataatccaaatgccgttgcaatcgatactcatatctatcaaatctctaaaaaa
tatctaccctctctagcaaacagctcctcttcattaactccaaaactctatcaagacatt
agtaacctttgggaatctattttcggtgatcatgcaggttgggctcaaactatactcttt
gcaaatgaattatcagtatttaaagaaaaatcaaaaaatattaaaattaaaaaagaaata
aatcaaaataataataataataatctaaaaattgaattaaaaaatgaaaaagaaaattta
aaaaatgaaaaagaaaatttaaaaagaaaaattataacaagatcaaccacttctactact
tctactacaacaaatactataaatgataatttaaatcctaaaaataaaaaaaagaaataa

DBGET integrated database retrieval system