KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0292786
Entry
DDB_G0292786      CDS       T00245                                 

Gene name
rad50
Definition
(RefSeq) DNA recombination/repair protein
  KO
K10866  DNA repair protein RAD50 [EC:3.6.-.-]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
ddi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0292786 (rad50)
   03450 Non-homologous end-joining
    DDB_G0292786 (rad50)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0292786 (rad50)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0292786 (rad50)
Enzymes [BR:ddi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     DDB_G0292786 (rad50)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     DDB_G0292786 (rad50)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     DDB_G0292786 (rad50)
    BRCA1-C complex
     DDB_G0292786 (rad50)
   NHEJ (non-homologous end-joining)
    MRX complex
     DDB_G0292786 (rad50)
SSDB
Motif
Pfam: AAA_23 SMC_N AAA_21 AAA_15 SbcCD_C AAA_29 ABC_tran AAA_13 HTH_51 Flavi_capsid AAA_16 BHD_1
Other DBs
NCBI-GeneID: 8628852
NCBI-ProteinID: XP_629462
dictyBase: DDB_G0292786
UniProt: Q54CS9
Position
6
AA seq 1351 aa
MTSIEKLLVQGIRSFDPREASVIDFYSPLTLIVGQNGAGKTTIIECLKYTCTGEMPPNCS
SGQAFIHDTKIAGESEVKAQIKLRFKNPIGKPIVASRSLSLIQKSNKKQEYKQIDASLQS
YTSDGQKVSKSFRCSDMDKEIPDLMGVAKPILKHVIFCHQEDSNWPLSESAKLKLKFDEI
FSAVKYTKALKSLKDKRKELTTLIKELKLRLETISANIEHCNRIRKELIKAEEIYSNGNK
SLEDIKIAIIEKQKTLSTIKIAESKLQELKNEVTVLNARKLEMERVKNQLFNSLTEVYQN
ETDEELVFMQSEFNRECETMATAEKELLENSEVLLSQKEVINNLIKENSSQKGRLQSLIS
QQDSILSDRDKQMKELVTRYKMSDFIQIQLPYQKEIVIKFINEITQKFDTLTSGISNYSK
TNKQKLNAIQMKINQKRVDSNQFTSSSNEKMSTITLNSKKIQSLDQEIQQHTNSIGEIDT
LEKQIQFSQSELSILKSDANLQEIQQSLDNLTTEKLEIEKEIQSLQSSLKLLNLQASSRT
RLNIKRKEIQQNQQNINSQLNSQIINSINLILPNEFNNDNNNDDDDDQFRFNIIQRIEPI
VPLINKKRLIFTNQLNELKQQFQILQNKKNQIDAQLTSSIEPQLKKKQIELESYEKLIND
SKLKQSNLFENVNSNNNNNNNNNNGITVLLFENKINEMKLSLEKLEKSFIVLESEDILYK
EYIEKANQDKECSLCKNEMNGNELTSFVHTLETHCNDIPNQLKQLKIEISNSKIQLEKFN
KLLPIIVKREELIEKSIPELKESQKNLLEQQLKSNEMVLEKQNQIESLESQSVLYQQVTL
VFQYIDQTKQSIQSIESEIQKEEKEIMKQSSDLRTIEEVDKDLEIQQEQLKTIEKEISNF
TNKQKNDQIGIFEKERQLISIKNQLTTIKSASGIIDHLRDTKKELQSNNQQLQLEIENLQ
QSIDQSNNDAKQLENEFQQLEIEFEKKIDAYSKEKNTFSVRLDSINSLQSKILDPSELCK
QLNEIQEKNQELESNLSTLSQDYLIGQQHISTIQQNLSSKDITKRAISDNISFRQHKNNV
EQIIRQISRKNELIKEMMQSQLEIDSNKLEQEINSLKSKFDQITGQTAVLQSQINSNRQE
LSKPTYKNIDDVNKDLLIKLQTTETVGKDLDKYYKALDKSLMKYHTLKMDEINRSIKEIW
QTTYKGSDIDTIEIRSEESGTANKTINYRVVMIKGDVELDMRGRCSAGQKVLACLVIRLA
LAENFCSNCGILALDEPTSHLDRANIESFANSLLNIIESRKSQKGFQLIIITHDEEFVQY
LSRGNYCDYYWRVTKNANQHSHLERKEIAEL
NT seq 4056 nt   +upstreamnt  +downstreamnt
atgacatcaattgaaaaattattagttcaaggtattcgtagttttgatccaagagaagca
agtgttattgatttttattcaccattaacattaatagttgggcaaaatggtgctggtaaa
actacaattatagaatgtttaaaatatacatgcacaggtgaaatgccaccaaattgttca
agtggtcaagcatttatacatgatacaaagatagcaggtgaatcagaagttaaagcacaa
attaaattaagatttaagaatccaattggtaaacctatagtagcatcaagatcattatca
ttgattcaaaaatcaaataagaaacaagagtataagcaaatcgatgcatcattacaatca
tatactagtgatggtcaaaaagttagtaaatcatttagatgtagtgatatggataaagag
ataccagatttaatgggtgtagcgaaaccaatacttaaacatgttatattttgtcatcaa
gaggattcaaattggcccctatcggaaagtgctaaattgaaattgaaattcgatgaaatc
ttctctgctgtaaagtacacgaaagcattgaaatctttgaaagataaaagaaaagagttg
accacattaatcaaggaattaaagctaaggctagagacaatctctgccaacattgagcat
tgtaatcgtattagaaaagagttgatcaaagccgaagagatctactcaaatggtaataaa
agtttagaggatattaaaattgcaatcatagagaaacaaaagacattgtcaactataaag
attgctgaatcgaaattgcaagagttaaaaaacgaagttacagttttaaatgcaaggaaa
ttagagatggagagagtcaagaatcaattattcaattcgttgactgaggtataccaaaat
gagaccgatgaggaattggttttcatgcaaagtgaattcaatcgtgaatgtgaaacaatg
gcaaccgcagagaaagagttgttggagaattcagaggtattgttatctcaaaaggaggtc
atcaataatttaatcaaagagaatagttcacaaaagggtagattacaatcactgatttcg
caacaagactcaatactatccgatagggataaacagatgaaagaattggttacacgttat
aaaatgtcggatttcattcaaattcaattaccctaccaaaaggagatcgtcattaaattc
atcaatgaaatcacacaaaagtttgatacactaacaagtggtatttcaaattattccaaa
acaaacaaacaaaagttaaatgctattcaaatgaaaatcaatcaaaaacgtgtagactct
aatcaatttacatcatcatccaatgagaaaatgtcaacgataactttaaattcaaagaaa
attcaatcattagatcaagagattcaacaacatacaaattcaattggtgaaattgataca
ttggagaaacaaattcaattttctcaatctgaattatcaatattaaaatcggatgcaaat
ttacaagagattcaacaatcattagataatttaactacagagaaattagaaattgaaaaa
gagattcaatcattacaatcttctttaaaattattaaatcttcaagcaagttcacgtaca
agattaaatataaaaagaaaagaaattcaacaaaatcaacaaaatattaattcacaatta
aattcacaaattattaattcaattaatttaattttaccaaatgaatttaataatgataat
aataatgatgatgatgatgaccaatttagatttaatataattcaaagaattgaaccaata
gtaccattaataaataaaaaaagattaatattcacaaatcaattaaatgaattaaaacaa
caatttcaaatattacaaaataaaaagaatcaaattgatgcacaattaacttcaagtatt
gaaccacaattaaaaaagaaacaaattgaactcgaatcatatgaaaaattaataaatgat
agtaaattaaaacaatcaaatttgtttgaaaatgtaaatagtaataataataataataat
aataataataatggtataacagttttattatttgaaaataaaattaatgaaatgaaatta
tcattagagaaattagagaaatcatttattgtacttgaaagtgaagatattttatataaa
gagtatatagagaaagctaatcaagataaagaatgttctttatgtaagaatgaaatgaat
ggtaatgaattgacttcatttgttcatacattagaaactcattgtaatgatataccgaat
caattgaaacaattgaaaattgaaattagtaattctaaaattcaattagagaaatttaat
aaactattaccaatcattgtaaagagagaagaactcattgaaaaatcaataccagaatta
aaagaatctcaaaagaatctattagaacaacaattgaaatcaaatgaaatggttttagag
aaacaaaatcaaattgaatcattagaatctcaatctgttttatatcaacaagttacccta
gtttttcaatatatcgatcaaactaaacaatctattcaatcgattgagagtgaaattcaa
aaggaggaaaaagaaatcatgaaacaatcatctgatcttagaaccattgaagaggttgat
aaggatttagagattcaacaagagcaattgaaaaccattgaaaaggaaatttcaaatttt
acaaataaacaaaagaatgatcaaattggaatctttgaaaaagaaagacaacttatctca
attaaaaatcaattgacaacaattaaaagtgcttctggtattatagatcatctaagggat
acaaagaaagagttacaatcaaataatcaacaattacaattagagattgaaaatttacaa
caatcaatagatcaatccaataatgatgctaaacaattggagaatgaatttcaacaattg
gaaattgaatttgaaaagaaaatcgatgcatattcaaaggaaaagaatactttttcagta
cgtttagattcaatcaatagtttacaatcgaaaatactcgacccatctgaactctgcaaa
caattgaatgaaattcaagagaaaaatcaagaattggaatcaaatctttcaactctttct
caagattacttaattggtcaacaacatatttcaaccattcaacaaaatctatctagtaaa
gatattaccaaaagagctatctctgataatatctcttttcgtcaacataagaacaatgtc
gaacaaatcattagacaaatcagcagaaagaatgaattaatcaaagaaatgatgcaatca
caattggaaattgattcaaataaattggaacaagaaataaattcattgaaatcaaaattc
gatcaaatcactggtcaaactgcagtactacaatctcaaatcaattcaaatcgtcaagaa
ctttcaaaaccaacttataaaaatattgatgatgtcaataaggatctattgattaaactt
caaaccactgaaaccgttggtaaagatttagataaatattataaagcattggataaatca
ttaatgaaatatcatactttgaaaatggatgaaattaatcgttcaattaaagagatttgg
caaacaacctataaaggtagtgatatagatacaattgaaatccgttccgaagaatctggt
actgcaaataaaacaattaattatcgtgttgttatgatcaagggtgatgtagaattagat
atgagaggtagatgtagtgcaggtcaaaaggtattggcatgtctggtgattcgtttagca
ttggctgaaaacttttgttcaaattgtggtatcttggctttagatgaaccaacctctcat
cttgatcgtgcaaatattgaatcatttgcaaactctttattaaatattatagaatcaaga
aaatctcaaaaaggttttcaattaataatcatcactcatgatgaagaatttgttcaatat
cttagtagaggtaattattgtgattattattggagagttactaaaaatgcaaatcaacat
agtcatttagaaagaaaagaaattgctgaactttaa

DBGET integrated database retrieval system