KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0293546
Entry
DDB_G0293546      CDS       T00245                                 

Gene name
mre11
Definition
(RefSeq) 3'-5' exonuclease
  KO
K10865  double-strand break repair protein MRE11
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi03440  Homologous recombination
ddi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DDB_G0293546 (mre11)
   03450 Non-homologous end-joining
    DDB_G0293546 (mre11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ddi03032]
    DDB_G0293546 (mre11)
   03400 DNA repair and recombination proteins [BR:ddi03400]
    DDB_G0293546 (mre11)
DNA replication proteins [BR:ddi03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     DDB_G0293546 (mre11)
DNA repair and recombination proteins [BR:ddi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     DDB_G0293546 (mre11)
    BRCA1-C complex
     DDB_G0293546 (mre11)
   NHEJ (non-homologous end-joining)
    MRX complex
     DDB_G0293546 (mre11)
SSDB
Motif
Pfam: Mre11_DNA_bind Metallophos HIRAN DUF3246
Other DBs
NCBI-GeneID: 8629281
NCBI-ProteinID: XP_628997
dictyBase: DDB_G0293546
UniProt: Q54BN2
Position
6
AA seq 689 aa
MEEEEIIEPKDFENEESENIQMDENEKQIPIQTTNDPQNKNIMRILVATDNHLGYLERDP
IRGDDSFNSFEEILKYAHTLKVDMVLLGGDLFHDNKPSRSCLYRTMELFRKYCLGDSPVR
IQFLSDQSVNFSNQFHTVNYEDPNFNISLPIFSIHGNHDDPTGEGGLAALDLLSVSNLVN
YFGKTEDIDDITVYPLLLGKGETKIAIYGLGNIRDERLHRTFQKQSVKLMRPVESKDEWF
NILVLHQNRVAHNPKNYVHEKMIESFIDFVLWGHEHECLVNPQASSVGEFHISQPGSSVA
TALSEGESKDKFVGLLEVYKNQFRFKPFPLNTVRPFIMDQIILANSNIHPTQQNDVIQWI
EQKVESMIEQAKLKSQGKPNESMLPLIRLKVDYTGYSTINPQKFGQRFQGRVANPNDVLL
FHRKKPTTLSSKKQKDGGELDVNSIKEKEEDKVKVADFISEFLGNTPNDRLQILSENDLF
NSLHSFVEKDETDSILKMVDLSLKSTQKYLNSKISSKDAYPDFIAKYIDDNFPLPHQNVS
SVNSDLLPINNPNEFESNLLDEDSHGHEHGHSHNHSQMIDNDDDENILNQRTIFKSPQSN
KTAPTTTTTTTTTTSSQISTRRKSSTQSSTQSSQTSIIIDDDDDDDEINEDNDDNDKDFE
SDEEKTPPSKKRGKVKQVGSVSKRSRSKK
NT seq 2070 nt   +upstreamnt  +downstreamnt
atggaagaagaagaaataattgaaccaaaagattttgaaaatgaagaatcagaaaatatc
caaatggatgaaaatgaaaaacagataccaattcaaactacaaatgatccacaaaataaa
aatataatgagaattttagttgcaacagataatcatttaggatatttagaaagagatcca
attagaggtgatgattcatttaattcatttgaggagatattaaaatatgcacatacatta
aaagttgatatggtattattgggtggtgatttatttcatgataataaaccatcaagatca
tgtttatatcgtacaatggaattatttagaaagtattgtttaggtgattcaccagttaga
attcaatttctatcggatcaatctgttaatttttcaaatcaatttcatacagtgaattat
gaagatccaaattttaatatttcattaccaatattttcaatccacggtaatcacgatgat
ccaactggtgagggtggtttggcagctttagatttattatcagtttcgaatctagtcaat
tatttcggtaaaactgaagatattgatgatattacagtctacccattactacttggtaaa
ggtgagacaaaaatagcgatctacgggttaggtaatattagagatgagcgtttgcataga
acttttcaaaagcaatcagtgaaattaatgagaccggtggaatcaaaagatgaatggttc
aatattttagtacttcatcaaaatagggtagcccacaatccaaagaattatgttcacgag
aagatgatagaaagtttcatagatttcgttctatggggacacgaacatgaatgtttagtc
aatccacaggcatcgtcagtgggagaattccatatttcacaacctggttcttcagtagct
acagctttatcagagggtgaatcaaaggataaatttgtaggattgttggaggtttataaa
aatcaattccgttttaaaccattcccattgaacacggttagaccattcattatggatcaa
atcatacttgcaaatagtaacatacatccaacacaacagaatgatgtaattcaatggatt
gagcaaaaagtagaatcaatgattgaacaagccaaattaaaatctcaaggtaaacccaac
gaatcaatgttaccattgataagattaaaagttgattatactggttatagtactatcaat
cctcaaaagtttggtcaaagatttcaaggccgtgtagcaaatccaaatgatgttttatta
ttccacagaaagaaaccaaccactttatcaagtaaaaaacaaaaggatggtggtgaattg
gatgtgaattcaatcaaagaaaaagaagaagataaagtgaaagtggccgatttcataagt
gaattcttgggtaatacaccaaatgatcgtttacaaattctatcagagaatgatctattc
aatagtttacattcattcgttgaaaaggatgaaaccgattcaatattgaaaatggttgat
ctctctttaaaatcgactcaaaaatatttaaattcaaaaatctcttcaaaagatgcttac
ccagatttcattgctaaatatattgatgataatttcccattaccacatcaaaatgtatct
tcggtcaattcagatttattaccaataaataatccaaatgaatttgaatcaaatttatta
gatgaagattctcatggtcatgaacatggtcatagtcataatcatagtcaaatgattgat
aatgatgatgatgaaaacattttaaatcaaagaacaatttttaaatcaccacaatcaaat
aaaacagcaccaacaacaactactaccaccactactactacatcttcacaaatttcaaca
agaagaaaatcttcaactcaatcttcaactcaatcttcacaaacttcaattataatagat
gatgatgatgatgatgatgaaattaatgaagataatgatgataatgataaagattttgaa
agtgatgaagagaaaactccaccatcaaagaaaagaggtaaagttaaacaagttggttca
gtttcaaaaagatcaagatcaaagaaataa

DBGET integrated database retrieval system