KEGG   Drosophila erecta: 6543367
Entry
6543367           CDS       T01060                                 

Definition
(RefSeq) chorion transcription factor Cf2 isoform X2
  KO
K02215  chorion factor 2
Organism
der  Drosophila erecta
Pathway
der04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:der00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    6543367
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:der03000]
    6543367
Transcription factors [BR:der03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    6543367
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_2 zf-Di19 zf-C2H2_6 zf-CHCC Zip zf-C2H2_9 zf-H2C2_5 zinc_ribbon_9
Other DBs
NCBI-GeneID: 6543367
NCBI-ProteinID: XP_001968722
FlyBase: FBgn0116477
UniProt: B3N4B1
Position
Unknown
AA seq 476 aa
MIKSTTNPQEQRLPRPEDQSPAPPPPPSSATSTTAPATPTHQVATVIANMDTLKTAFLPN
LSMDPNVHVSPHYCPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQHPK
LSHPCFNCDEKFGNAVDLDEHHRLAHQTSAFLARCLICSIYGIHSATQQPNEYKCTQCGS
ICTTAMLAAGQQGFMEQQEAAVTPDDQLPSMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQ
QQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIV
AHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVAADLAHKIRH
KCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGE
KPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgataaagtccaccacgaatccacaggaacagcgtctgccacgccccgaggatcagtcg
ccagcgccgccgccgcccccctcctcagccacctccaccaccgcccctgccacccccacg
caccaagtggccaccgtgatagccaacatggacaccctgaagaccgcctttctgcccaat
ctcagcatggatcccaatgtgcacgtgtcgccgcactattgtcccatgtgccaccagcag
ttcgagcggccgcagcatgtcgcggatcacatgcagctgtgccacgggataacgctgaac
gcccagggagccatcgccacgctggacggtggccatccgcaggcacagcagcaccccaag
ctcagccacccctgcttcaattgtgatgaaaagtttggcaacgccgtcgacctggacgaa
caccatcggctggctcatcagacgtccgccttcctggcccgctgcctcatttgcagcatc
tatggcatccactcggccactcagcagcccaacgagtacaaatgcacgcagtgcggctcc
atttgcaccaccgccatgctggccgccggacagcagggctttatggaacagcaggaggcg
gcggtgacgcccgacgaccagctgccgtcgatggcgccccgtgatatgagactgacgccc
gaggagcagcaccaccagcagcaactgcaggcggagcaccaccatcagcaacagcaccaa
caacagcagcagcagcaggaactgctggagcagcagcagcgtgaaatgcaggagcaggcg
caacagcagcaggtgcatcatcaccagcaggatcaggatctcgccggcgaccaggtggcg
ctgaaggtgccaccgctcaccgtcaagctaaacaagaatgccaacggtggcgccattgtg
gcccacccgcaggtcattatcaaggaggagccactcagcctgagcgatagtggtgatgtg
gtcaactctgtgcccgtctatgccatacaagccaatcccggtgtacccgctccggccagt
tcgggtgtgctagtcggcacgcaaacggtggccgccgatctggcgcacaagatccggcac
aaatgcccggattgtccaaagaccttcaagacgcccggcactctggcaatgcaccgcaag
atacacacaggcgaagcagacgccacgcccaaagaacgcccctacacgtgctcctactgc
ggcaagtccttcactcaatcgaatacactaaaacagcacactcgcatacatacaggagag
aagccgtttcactgcgggtactgcgagaagtccttcagcgtgaaggactatctgaccaag
cacatacggacgcacaccggcgagaagccgtacacctgtccgtactgtgacaagcgtttc
acgcagcgcagcgcccttactgtgcacacgaccaagctgcatccgctctag

DBGET integrated database retrieval system