KEGG   Drosophila hydei: 111605472
Entry
111605472         CDS       T05888                                 

Definition
(RefSeq) chorion transcription factor Cf2 isoform X1
  KO
K02215  chorion factor 2
Organism
dhe  Drosophila hydei
Pathway
dhe04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    111605472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dhe03000]
    111605472
Transcription factors [BR:dhe03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    111605472
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 RskA zf-C2H2_11 Zn-ribbon_8 zf-Di19 zf-C2H2_6 Desulfoferrod_N CTU2 zf-C2H2_jaz EPL1 zf-C2H2_2 DUF2992 TCP zf-CHCC zinc_ribbon_9 DUF4746 eIF-3_zeta zf-C2H2_9 zf-C2HC_2 Gti1_Pac2 Prok-RING_2 DUF1387 Presenilin Zn_ribbon_SprT ABC2_membrane_2
Other DBs
NCBI-GeneID: 111605472
NCBI-ProteinID: XP_023179759
UniProt: A0A6J1ME56
Position
Unknown
AA seq 549 aa
MLKSSTNPQELRLPRPEEHHQPHPHTQQGQPTHQVAAVIANNITSAAAAAAAAAAAAAAA
GGSAVPTSHSMDTLKTTFLPNLSMDPNVISPHYCPMCHQQFERIQHAAEHMQLCHGISLN
AQSALIEQQQHQQQQQQQQQQQQQQQQQLKPLSYACPNCDDKFASALEVDEHHRLTHQTA
FLARCIVCSVYGVNSVTQNPNEYKCSHCGNVFNAAMLTTGQQAFMDHQEAPVTPDEMPAI
APRDMRLTPEEQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQVQHHQQDHHHQQLEQQQQQ
EQQRQRELQEQQHQEDLSDPSTQKVPPLTVKLLKNGTGATVAHPQVIIKEEPLSLSDSGD
VVNSVPVYAIQANPGVQPAGTTGAATSVLVSTQSVPADLAHKIRHKCPDCPKTFKTPGTL
NMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFRCGFCGRAFTVK
DYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALT
VHTTKLHPL
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgttaaagtctagcacaaacccacaggaattgcgtctgccacggcccgaggaacaccat
cagccacatccgcacacgcaacagggacagccgacgcatcaagtggccgccgtgatagcc
aacaacataacgtctgcagcagccgcagccgccgccgcagccgcagcagcagcagcagca
ggaggatcagcagtccccaccagccacagcatggacacgcttaagacaacatttctgccc
aatctcagcatggatccgaatgtcatcagtccgcactactgccccatgtgccatcagcag
ttcgagcgcatccagcatgccgcggagcatatgcagctctgccatggcatctcactcaat
gcccagagtgctctcatcgaacagcagcagcatcagcagcagcagcaacagcaacaacaa
cagcagcagcagcagcagcagcaattgaaaccgctaagctatgcgtgtcccaactgtgat
gataagtttgccagcgcgctggaggtggatgagcaccatcggctgacgcatcagacggca
tttttggcgcgctgcattgtgtgtagcgtttatggcgtcaattctgtaacgcagaatccc
aacgaatacaaatgctcgcactgcggcaacgtattcaatgcggccatgctgacgactgga
cagcaagcgtttatggatcatcaggaggcgccggtgacgcctgacgaaatgccagccata
gcgccgcgtgatatgagactgacgcccgaagagcagcaacaccagcagcagcagcaacaa
caacagcaacaacaacaacagcagcagcagcagcagcagcaacaacaacagcagcagcag
caagtccagcaccaccagcaggatcaccatcaccagcaactcgaacaacaacaacagcag
gagcaacaacgacaacgtgaactccaggagcaacagcatcaggaagacttgagcgatccg
tcaacacaaaaagtgccgcccctaacagtgaaactgcttaagaacggcacaggagcaaca
gtagcacatccgcaggtcatcattaaggaggaaccacttagtttgagcgatagcggtgat
gtagtcaattcagtgcctgtctatgccatacaagcgaatcctggagtacagccggcgggc
acaacaggcgccgccaccagcgtattggttagcacgcaatcggtgcccgcggatctggcg
cacaagatccgacataaatgtcccgattgccccaaaacatttaagacgcccggcacactg
aacatgcaccgcaaaatacacacgggcgaagcagacgccacgcccaaagaacgcccctac
acgtgctcctactgcggcaagtccttcactcaatcgaatacactaaaacagcacactcgc
atacatacaggtgagaaaccatttagatgtggcttttgtggcagggcgttcactgttaag
gattacctgaacaaacatttaacgactcacacgggtgaaaaaccatttcattgtggctac
tgtgagaagtccttcagcgtgaaggactatctcacgaaacacatacgcacacacaccggc
gaaaagccgtacacctgtccgtactgtgacaaacgattcacgcaacgcagcgcactcacc
gtgcacacgacaaagctgcatccgctctag

DBGET integrated database retrieval system