KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0569900-01
Entry
Os02t0569900-01   CDS       T02163                                 

Gene name
Os02g0569900
Definition
(RAP-DB) Cytochrome P450 family protein.
  KO
K16084  ent-cassa-12,15-diene 11-hydroxylase / oryzalexin D synthase [EC:1.14.14.112 1.14.14.123]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00904  Diterpenoid biosynthesis
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    Os02t0569900-01 (Os02g0569900)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dosa00199]
    Os02t0569900-01 (Os02g0569900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.112  ent-cassa-12,15-diene 11-hydroxylase
     Os02t0569900-01 (Os02g0569900)
    1.14.14.123  oryzalexin D synthase
     Os02t0569900-01 (Os02g0569900)
Cytochrome P450 [BR:dosa00199]
 Cytochrome P450, plant type
  CYP76 family
   Os02t0569900-01 (Os02g0569900)
Motif
Pfam: p450
Other DBs
RAP-DB: Os02t0569900-01
Position
chr02:21740346..21741845
AA seq 499 aa
MENSQVWLLWGALSVAVLFYLSTLRRRYAGGKPLPPGPTPLPLIGNLHLAGGTFHHKLRD
LARVHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVFI
PSSDPQWKALRGIQGSHVFTPRGLAAVRPIRERKVGDLIAYLRAHAGEEVLLGQAMYTGL
LNLVSFSYFSIDIVDMGSQMARDLREVVDDIISVVGKPNISDFYPFLRPLDLQGLRRWTT
KRFNRVFSIMGDIIDRRLAHIRDGKPRHDDFLDSLLELMATGKMERVNVVNMLFEAFVAG
VDTMALTLEWVMAELLHNPAIMARVRAELSDVLGGKEAVEEADAARLPYLQAVLKEAMRL
HPVGALLLPHFAAEDGVEIGGYAVPRGSTVLFNAWAIMRDPAAWERPDEFVPERFLGRSP
PLDFRGKDVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWKLPGGMTAEDVDVSEK
FKSANVLAVPLKAVPVLIK
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggagaatagccaggtgtggctgctatggggagctctctccgtcgctgtcctcttctac
ctctccaccctgcgacgacgctacgccggcggcaaacccctccccccgggcccgacgcca
ctgccgctcatcggcaacctccacctggccggcggcacgttccaccacaagctcagggac
ctggcgcgcgtccacggccccgtgatgacgctcaagctcggcctcgccaccaacgtggtc
atctcctcccgggaggccgccatcgaggcgtacaccaagtacgaccgccacctcgccgcg
cgcgccactccggacaccttccgcgcgtgcggcttcgccgaccgctccatggtgttcatc
ccgagctccgacccgcagtggaaggccctgcgcgggatccagggctcccacgtcttcacc
ccgcgtggccttgccgccgtgcgccccatccgtgagcggaaggtgggcgacctcatcgcc
tacctccgcgcgcacgccggcgaggaggtgctcctcggccaggccatgtacactggcctc
ctcaacctcgtgtccttctcctacttctccatcgacatcgtcgacatgggctcgcagatg
gcccgcgacctgcgggaggtggtggacgacatcatctcggtggtcgggaagcccaacatc
tccgacttctacccgttcctccggccgctggacctgcagggcctgcgccgctggacgacg
aagcggttcaacagggtgttctccatcatgggcgacatcatcgaccgccgcctggctcac
atccgcgacggcaagccgaggcacgacgacttcctcgactcgctcctcgagctcatggcc
accggcaagatggagcgtgtcaacgtggtgaacatgctgttcgaggccttcgtcgccggc
gtggacaccatggccctcaccctggagtgggtgatggccgagctgctccacaacccggcc
atcatggcgagggtgcgcgcggagctgagcgacgtgctcggcgggaaggaggccgtggag
gaggccgacgcggcgaggctgccctacctccaggccgtgctgaaggaggccatgaggctg
cacccggtgggcgcgctgctgctgccgcacttcgccgcggaggacggcgtggagatcggc
ggctacgcggtgccgaggggctccacggtgctcttcaacgcgtgggcgatcatgcgcgac
ccggcggcgtgggagaggcccgacgagttcgtgccggagcgcttcctggggaggtcaccc
ccgctggacttcagggggaaggacgtggagttcatgccgttcgggtccgggaggcggctg
tgccccgggctgccgctggcggagcgcgtcgtgccgttcatcctggcgtcgatgctgcac
acgttcgagtggaagctccccggcggcatgacggcggaggacgtggacgtgtccgagaag
ttcaagtctgccaatgtgcttgccgtgcctctcaaggccgtgcctgtcctgatcaaatag

DBGET integrated database retrieval system