KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os02t0571900-01
Entry
Os02t0571900-01   CDS       T02163                                 

Gene name
Os02g0571900
Definition
(RAP-DB) Cytochrome P450 family protein.
  KO
K21718  oryzalexin E synthase [EC:1.14.14.122]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00904  Diterpenoid biosynthesis
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    Os02t0571900-01 (Os02g0571900)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dosa00199]
    Os02t0571900-01 (Os02g0571900)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.122  oryzalexin E synthase
     Os02t0571900-01 (Os02g0571900)
Cytochrome P450 [BR:dosa00199]
 Cytochrome P450, plant type
  CYP76 family
   Os02t0571900-01 (Os02g0571900)
Motif
Pfam: p450
Other DBs
RAP-DB: Os02t0571900-01
Position
chr02:complement(21904649..21906187)
AA seq 512 aa
MEKLKSELWMTAVATCMSLLLYLTILRRRHASGGRSLALPPGPTPLPLIGNLLCLGGIFH
QTLAKLARVHGPVMTLKLGLTTAVVVSSAEAAREAYTKHDQRLAARPVPDAFRANGFSER
SIVFSPSSDPQWKNLRGIHATHIFSPRALAALRGIRERKVRDIVGYIRTVAGEEMCVREV
VHNGVLNLISTSFFSMDMADVRSESARGLRGLIEDIIATVAGPNVSDFFPFLRQLDLQGL
RRQTGSHLGIVFGLLDDIIDRRMAETRDHPDKQRHGDFLDALISLASAGKIPRYHITYLL
FDVFAAGADTMTTTVEWAMAELLRNPRVMAKVRAEVTDALGGRESFDEGDAASLTYLQCV
FKEAMRLHPVGSILVPHLAVQDGVEIGGYAVPKGTTVIFNAWAIMRDPAAWESPDQFLPE
RFLHKEESSSPPLELRGKDYEYIPFGSGRRLCPGLPLAERAVPFILASLLHAFEWRLPDG
MSPDDMDMTEKFATANVLATPLKAVPVASHTS
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggagaagctgaagagcgagctatggatgacagcggtggccacctgcatgtcgctcttg
ttgtacctcaccatcctgagacggcgccacgcgagcggcggcagatcactagcattgccg
ccggggccaacgccactcccgctcatcggcaacctactctgccttggcggcatcttccac
caaaccctcgcgaaactggcgcgcgtccatggccctgtcatgacgctgaagctaggcctc
accacggccgtggtcgtgtcgtcggccgaggccgcgagggaggcctacacgaagcacgac
cagcggctcgccgcgcggccggtcccggacgccttccgcgcgaacggcttctccgagcgg
tccatcgtgttctcgccgagctccgatccgcagtggaagaacctgcggggcatccacgcg
acgcacatcttctcccctagagccctcgcggcgctgcgcggcatccgcgagcgcaaggtg
cgggatatcgtcggctacatccgcacggtcgccggggaggagatgtgtgtccgcgaggtc
gtgcacaacggcgtgctcaacctcatatccacctccttcttctccatggacatggctgac
gtgcgctcggagtcggcgcgcgggctacgcgggctgatagaggacatcatcgcaaccgtc
gcgggccccaacgtgtccgactttttccctttcctccggcagctcgacctgcagggcttg
cgtcgacaaacgggcagccatcttggcatcgttttcgggttgttggacgacataatcgat
cgccgcatggccgaaacccgtgaccaccctgacaagcagcggcacggcgacttcctggac
gcgctcatcagcctcgcctccgccggcaagatcccacgctaccacatcacgtaccttctg
ttcgacgtctttgcggctggcgccgacacgatgacgaccaccgtggagtgggcgatggcc
gagctgcttcgcaatccccgcgtgatggccaaggtgcgggcggaggtgacggacgcgctc
ggcggcagggagagcttcgacgagggcgacgcggcgagcctcacgtacctccagtgcgtg
ttcaaggaggcgatgcggctgcaccccgtgggctcgatactggtccctcacctggcggtg
caggacggcgtcgagatcggtggctacgccgtgcccaagggcaccacggtgatcttcaac
gcgtgggcgatcatgcgcgacccggcggcgtgggagagccccgaccaattcctaccggag
cgcttcttgcacaaggaggagtcctcatcacctccgctggaattgcgagggaaagactac
gagtacatcccgttcgggtccggcaggaggttgtgccccggcctgccactggcagagcgc
gccgtgcccttcatactggcgtccctgctgcacgcgttcgagtggcggcttccggacggc
atgtcgcctgatgacatggacatgactgagaagtttgccactgctaacgtgcttgctacc
cctttgaaggctgtgccagtcgcgtcacacactagttag

DBGET integrated database retrieval system