KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os04t0101400-01
Entry
Os04t0101400-01   CDS       T02163                                 

Symbol
Os04g0101400
Name
(RAP-DB) Cytochrome P450 family protein.
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00941  Flavonoid biosynthesis
dosa01100  Metabolic pathways
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    Os04t0101400-01 (Os04g0101400)
   00943 Isoflavonoid biosynthesis
    Os04t0101400-01 (Os04g0101400)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dosa00199]
    Os04t0101400-01 (Os04g0101400)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     Os04t0101400-01 (Os04g0101400)
Cytochrome P450 [BR:dosa00199]
 Cytochrome P450, plant type
  CYP93 family
   Os04t0101400-01 (Os04g0101400)
SSDB
Motif
Pfam: p450 DUF6237
Other DBs
RAP-DB: Os04t0101400-01
Position
chr04:complement(join(100702..101622,99974..100603))
AA seq 516 aa
MASLMEVQVPLLGMGTTMGALALALVVVVVVHVAVNAFGRRRLPPSPASLPVIGHLHLLR
PPVHRTFHELAARLGPLMHVRLGSTHCVVASSAEVAAELIRSHEAKISERPLTAVARQFA
YESAGFAFAPYSPHWRFMKRLCMSELLGPRTVEQLRPVRRAGLVSLLRHVLSQPEAEAVD
LTRELIRMSNTSIIRMAASTVPSSVTEEAQELVKVVAELVGAFNADDYIALCRGWDLQGL
GRRAADVHKRFDALLEEMIRHKEEARMRKKTDTDVGSKDLLDILLDKAEDGAAEVKLTRD
NIKAFIIDVVTAGSDTSAAMVEWMVAELMNHPEALRKVREEIEAVVGRDRIAGEGDLPRL
PYLQAAYKETLRLRPAAPIAHRQSTEEIQIRGFRVPAQTAVFINVWAIGRDPAYWEEPLE
FRPERFLAGGGGEGVEPRGQHFQFMPFGSGRRGCPGMGLALQSVPAVVAALLQCFDWQCM
DNKLIDMEEADGLVCARKHRLLLHAHPRLHPFPPLL
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggcatcgttgatggaagtgcaggtgccgctgttgggaatgggcactacgatgggcgcc
ctggctctggctctcgtcgtcgttgtggttgtgcacgttgccgtgaacgcctttgggcgg
cggcggcttcccccgagtccggcgagcctaccggtgatcgggcaccttcacctgctccgg
ccgccggtgcaccgcaccttccacgagctggcggcgaggctgggccccctgatgcacgtc
cggctggggtcgacgcactgcgttgtggcgagctcggcggaggtggcggcggagctgatc
cgcagccacgaggcgaagatatcggagcggccgctgacggcggtggcccggcagttcgcg
tacgagtcggcggggttcgcgttcgcgccctacagcccgcactggcgcttcatgaagcgg
ctgtgcatgtcggagctgctgggcccgcgcacggtggagcagctgcgccccgtgcgccga
gccgggctggtgtcgctgctgcgccacgtgttgtcgcagccggaggcggaggcggtggac
ctgacccgcgagctcatccgcatgtccaacacctccatcatccgcatggccgccagcacg
gtccccagcagcgtgacggaggaggcgcaggagctggtgaaggtggtggcggagctggtg
ggcgccttcaacgccgacgactacatcgccctgtgccgtggctgggacctgcagggcctc
gggcgccgtgcggccgacgtgcacaagaggttcgacgcgctgctggaggagatgatcagg
cacaaggaggaggctaggatgcggaagaagacagacacagacgtcggcagcaaggacctg
cttgacatcctgctggacaaggcggaggacggcgcggcggaggtgaagctcaccagagac
aacatcaaggccttcatcatcgacgttgttactgccgggtccgacacttcggccgccatg
gtggagtggatggtggcggagctgatgaaccacccggaggccctgcgcaaggtgcgggag
gagatcgaggcggtggtggggcgggacaggatcgccggcgagggggacctgccgagactg
ccgtatctgcaggcggcgtacaaggagacgctgcggttgaggccggcggcgccgatcgcg
cacaggcagtcgacggaggagatccagatccgagggttcagggtgccggcgcagacggcg
gtgttcatcaacgtgtgggccatcgggcgagacccggcgtactgggaggagccgctggag
ttcaggccggagcggttcctcgccggcggcggcggcgagggcgtggagccgcgcgggcag
cacttccagttcatgccgttcgggagcggccggcgcgggtgccccgggatggggcttgcg
ctgcagtcggtgccggcggtggtggcggcgctgctgcagtgcttcgattggcagtgcatg
gacaataagttgatagacatggaggaggcagacggcctggtttgcgctcggaagcatcgc
ctcctcctccacgcccacccgcgcctccaccctttcccgccgctcctctag

DBGET integrated database retrieval system