KEGG   Oryza sativa japonica (Japanese rice) (RAPDB): Os06t0599200-01
Entry
Os06t0599200-01   CDS       T02163                                 

Symbol
Os06g0599200
Name
(RAP-DB) Cytochrome P450 family protein.
  KO
K16084  ent-cassa-12,15-diene 11-hydroxylase / oryzalexin D synthase [EC:1.14.14.112 1.14.14.123]
Organism
dosa  Oryza sativa japonica (Japanese rice) (RAPDB)
Pathway
dosa00904  Diterpenoid biosynthesis
dosa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dosa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    Os06t0599200-01 (Os06g0599200)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dosa00199]
    Os06t0599200-01 (Os06g0599200)
Enzymes [BR:dosa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.112  ent-cassa-12,15-diene 11-hydroxylase
     Os06t0599200-01 (Os06g0599200)
    1.14.14.123  oryzalexin D synthase
     Os06t0599200-01 (Os06g0599200)
Cytochrome P450 [BR:dosa00199]
 Cytochrome P450, plant type
  CYP76 family
   Os06t0599200-01 (Os06g0599200)
SSDB
Motif
Pfam: p450
Other DBs
RAP-DB: Os06t0599200-01
Position
chr06:23632521..23634023
AA seq 500 aa
MENSQVWLLWGALSVAVLFYLSTLRRRHAGGKPLPPGPTPLPLIGNLHLAGGTSFHHKLR
DLARVHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVF
IPSSDPRWKALRGIQGSHVFTPRGLAAVRPIRERKVGDLMAYLRAHAGEEVLLGQAMHTG
LLNLVSFSYFSIDIVDMGSQMARDLREVVDDIISVVGKPNISDFYPFLRPLDLQGLRRWT
TKRFNRVFSIMGDIIDRRLAHIRDNKPSHNDFLDSLLELMAAGKIDRVNVLDMLFEAFVA
GADTMALTLEWVMAELLKNPGVMAKARAELRDVLGDKEVVEEADAARLPYLQAVLKEAMR
LHPVGALLLPHFAVEDGVEVGGYAVPKGSTVLFNAWAIMRDPAAWERPDEFVPERFVERA
PLLDFRGKDAEFMPFGSGRRLCPGLPLAERVMPFILASMLHTFEWKLPGGMTAEDVDVSE
KFKSANVLAVPLKAVPVLIK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggagaatagccaggtgtggctgctatggggagctctctccgtcgctgtcctcttctac
ctctccaccctgcgacgacgccacgcgggaggcaagccccttcccccgggcccgacgccg
ctgccgctcatcggcaacctccacttggccggcggcacgtcgttccaccacaagctcagg
gacctggcgcgcgtccacggccccgtgatgacgctcaagctcggcctcgccaccaacgtg
gtcatctcctcccgtgaggccgccatcgaggcgtacaccaagtacgaccgccacctcgcc
gcgcgcgccaccccggacaccttccgcgcgtgcggcttcgccgaccggtccatggtgttc
atcccgagctccgacccgcggtggaaggccctgcgggggatccagggctcccacgtcttc
accccgcgtggcctcgccgccgtgcgccccatccgcgagcggaaggtgggcgacctcatg
gcctacctccgcgcgcacgccggcgaggaggtgctcctcggccaggccatgcacacgggc
ctcctcaacctcgtgtccttctcctacttctccatcgacatcgtcgacatgggctcgcag
atggctcgcgacctgcgggaggtggtggacgacatcatctcggtggtcgggaagcccaac
atctccgacttctacccgttcctccggccgctggacctgcagggcctgcggcgctggacg
acgaagcggttcaacagggtgttctccatcatgggcgacatcatcgaccgccgtttggct
cacatccgcgacaacaagccaagccataacgatttcctcgactcactcctcgagctcatg
gctgccggcaagatcgatcgggtcaacgtgctcgacatgttgttcgaggctttcgttgcc
ggggctgacaccatggctcttaccttggagtgggtgatggccgagctgctcaagaacccg
ggcgtgatggccaaggcgcgagctgagctgagggatgtgcttggcgacaaggaggttgtg
gaggaggccgacgcggcgaggctgccctacctgcaggccgtgctgaaggaggccatgagg
ctgcacccggtgggcgcgctgctgctgccgcacttcgccgtggaggacggcgtggaggtc
ggcggctacgcggtgcccaagggctccacggtgctcttcaacgcgtgggcgatcatgcgc
gacccggcggcgtgggagaggcccgacgagttcgtgccggagcggttcgtggagagggcg
ccgctgctggacttcagggggaaggacgccgagttcatgccgttcggctccgggaggcgg
ctgtgccccgggctgccgttggcggagcgcgtcatgccgttcatacttgcgtcgatgctg
cacacgttcgagtggaagctccccggcggcatgacagcggaggacgtggacgtgtccgag
aagttcaagtctgccaatgtgcttgctgtgcctctcaaggccgtgcctgtcctgatcaaa
tag

DBGET integrated database retrieval system