KEGG   Drosophila persimilis: 6588694
Entry
6588694           CDS       T01063                                 

Definition
(RefSeq) chorion transcription factor Cf2 isoform X3
  KO
K02215  chorion factor 2
Organism
dpe  Drosophila persimilis
Pathway
dpe04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dpe00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    6588694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dpe03000]
    6588694
Transcription factors [BR:dpe03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    6588694
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-CHCC zf-C2H2_2 zf-C2H2_6 zf-Di19 zf-C2H2_9 zinc_ribbon_9 EPL1 Spt20 zf-C2HE
Other DBs
NCBI-GeneID: 6588694
NCBI-ProteinID: XP_002015029
UniProt: B4G9J5
Position
Unknown
AA seq 426 aa
MDTLKTAFLPNLSMDPNVHVSPHYCPMCHQQFERAQHVTEHMQLCHGITLNSQGAITSLE
AAQQQHQQQQQQQQQQQQLKPNYSCVNCDEKFGSAVDLDEHQRMTHQAPAFLARCLVCSI
YGVHSATPNPNEYKCTQCGSVCTTSMLAAGQQSFMEQQEAPVTPDELPAIAPRDMRLTPE
EQHHQQQQQLQQEHHHQQQELLEQQQRELQEHQQQQHHQDDLSGDQVGLKVPPLTVKLNK
NSNGGSVAHPQVIIKEEPLSLSDSGDVVNAVPVYAIQANPGVQAPTPGAATSVLVSTRIV
TADQAHKIRHKCPDCPKTFKTLGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTL
KQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHT
TKLHPL
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggacacactgaagaccgcctttctgccaaatctcagcatggaccccaacgtccatgtc
agtccgcactactgtcccatgtgccaccagcagttcgagcgggcccagcacgttacagag
cacatgcagctgtgccacggcataacgctgaactctcagggagctatcacatcgctggag
gccgcccaacagcagcaccagcaacagcaacaacagcagcagcagcagcagcaactgaag
cccaactattcgtgcgttaactgtgatgagaagttcgggagcgccgtggatctggacgag
caccagcgaatgacgcaccaggcgcccgccttcctggcgcgttgcctcgtatgcagcatt
tacggagtgcattcggccacgccgaaccccaacgaatacaagtgcacgcagtgcggttcc
gtctgcacgacgtccatgctggcggcgggacagcagtcgttcatggagcagcaggaggcg
cccgtgacacccgacgagcttcccgccattgcgccgcgtgatatgagactgacgcccgaa
gagcaacatcaccagcagcagcagcagctgcagcaggagcaccatcatcagcagcaggaa
ctgcttgagcaacagcagcgggaactgcaggagcatcagcagcaacagcaccaccaggac
gatctttctggcgaccaggtgggcctcaaagtgccgccgctcaccgtcaagctgaacaaa
aattcgaatgggggctccgtcgcccatccccaggtcatcatcaaggaagagccgctcagt
ctgagcgatagtggcgatgtggttaacgctgtccccgtctatgccatacaagcgaatcct
ggcgtgcaggcaccgacccctggggccgccaccagtgtcctggtcagcacgcggatcgtg
acagcggatcaggcgcacaagatccggcacaaatgtccggactgcccgaagacattcaag
acgctgggaaccctggccatgcaccgcaagatccacacaggcgaagcagacgccacgccc
aaagaacgcccctacacgtgctcgtactgcggcaagtccttcactcaatcgaatacacta
aaacagcacactcgcatacatacaggtgagaaaccgtttcattgcggctactgtgagaag
tccttcagcgtgaaggactatctcaccaagcacatacggacgcacaccggcgaaaagccg
tacacctgtccgtattgcgataagcgcttcacgcagcgaagcgccctcaccgtgcacacg
accaagctgcatccgctctag

DBGET integrated database retrieval system