Dyadobacter pollutisoli: ON006_09665 Help Entry ON006_09665       CDS       T09794                                  Name (GenBank) NUDIX domain-containing protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism dpf  Dyadobacter pollutisoli Brite KEGG Orthology (KO) [BR:dpf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:dpf03400]     ON006_09665 Enzymes [BR:dpf01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      ON006_09665 DNA repair and recombination proteins [BR:dpf03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     ON006_09665  Prokaryotic type     ON006_09665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_2 NUDIX_4 Nudt16-like Motif Other DBs NCBI-ProteinID:  WAC14209 UniProt:  A0A9E8NCM0 Position 2343959..2344351 Genome browser AA seq 130 aa AA seqDB search MIDKLAFIEIQDKKVLVARTRGRNVYYLPGGKRETGESDEQALTREIEEELTIKIDPASV EFYGTFLAQAHGQPQGVMVNMRCYAGLYSGEIAPSAEIEEVAWLSYADREKVSEVDKIIF DDLKARELLD NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgatcgacaaattagcctttattgaaatacaagacaaaaaagtactcgttgcacgtacc cgggggcgcaacgtttactatctccctggcggaaaaagggaaaccggcgaatccgacgag caggccctgacccgggagatagaggaggagttaactatcaaaatcgatccggcgtctgtt gagttttatgggacattccttgctcaggcgcacggccagccccagggcgtgatggtgaat atgcgctgctatgcgggcttgtattccggcgagattgctccttccgcggaaatcgaagag gttgcatggttgtcttacgccgatagggagaaagtatcggaagtagacaaaattatattt gacgacctgaaagcaagggaactgctggactga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (4) Pfam (4) All databases (6) Download RDF

DBGET integrated database retrieval system