KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_74526
Entry
DICPUDRAFT_74526  CDS       T02090                                 

Name
(RefSeq) hypothetical protein
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
SSDB
Motif
Pfam: Dicty_REP UCH_N
Other DBs
NCBI-GeneID: 10509437
NCBI-ProteinID: XP_003283563
JGI: Dicpu1_74526
UniProt: F0Z7Z9
Position
Unknown
AA seq 179 aa
MALKGAGSLNEQSVALITSEKEKINQIRSFEDSHHYINFSRSQNPCLSLVDTRLSTLVLE
YNPSTIQHIAGFFDLCSLMVSKTDISGFNLQIASIMSSFLPTNIKNLSFERETALKEKLA
MTFSNSTVLNETFRIQNVKSVKRYLTISVTNKTFNACRIFAFSDVKKGFSISNLNYLFY
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcccttaagggagcagggtctttaaacgagcaatcagttgctttaataacaagcgaa
aaagaaaaaatcaatcaaattagaagctttgaagactcccatcattatattaatttttca
aggtctcaaaatccatgcctatcattggtagacactagattatcaacattggtcttagaa
tataacccaagcacgatccaacatatagctggtttttttgatttatgtagtttaatggtt
tcaaaaacagatatttcagggttcaatttacaaatagcctcaatcatgtcatcattctta
ccaaccaacattaaaaatctttcatttgaaagagagactgcattaaaggaaaaacttgca
atgacattttcaaacagtactgttctaaatgaaacctttaggattcaaaacgtaaaaagt
gttaaaagatatttaacaatttctgtaactaataaaaccttcaatgcatgcagaattttt
gcctttagtgatgtcaaaaagggattctcaatttcaaatttgaattatctattctattga

DBGET integrated database retrieval system