KEGG   Danio rerio (zebrafish): 100001558
Entry
100001558         CDS       T01004                                 
Symbol
cnga1a
Name
(RefSeq) cyclic nucleotide gated channel subunit alpha 1a
  KO
K04948  cyclic nucleotide gated channel alpha 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    100001558 (cnga1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    100001558 (cnga1a)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   100001558 (cnga1a)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding NPR3 Otopetrin Ctr DDHD
Other DBs
NCBI-GeneID: 100001558
NCBI-ProteinID: NP_001139095
ZFIN: ZDB-GENE-090312-66
Ensembl: ENSDARG00000029898
UniProt: B8JHY6 A0A8M1NTF4
Position
1:complement(43894525..43899422)
AA seq 697 aa
MTVVPTALGVAVPPRVSPIIEVEEDSENPISAPTPGRVFNVNNSNNNEEEEKKKKKEKKE
KKEKKEKKEKKEKKEKNQKNEKQKDNEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEK
EKKEGPKEVFVINPAGLLYYQWLLIITFPVMYNWTVIIARACFEELQHEYLLTWFLLDYT
SDLLYLADMAFRARTGYLEQGLLVKDEKLLLKRYTDSLQFRLDVISMLPTDIFYFILGLD
YPEIRINKLLRLNRMFEFFKISETMTNYPNIFRICTLVMYIIIIIHWNACLYFSFSKSIG
FGSDAWVYPALTEPEFGELMRKYSFSLYWSTLTLTTIGETPSPELDSEFFFHVVDFLVGV
LIFATIVGNIATMISNMNAAQAQFQARIDNIKQYMHARHVSKELEDRVIKWFDYLWTNKK
AQDEREVLRYLPDKLRAEIGMNVHLDTLKKVRIFADCEAGLLIELVLKLRPQVFSPGDYI
CRKGDIGREMYIIKDGKLAVVADDGVTQFVVLGDGSYFGEISILNIKGSKAGNRRTANIR
SIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILLKDGLLELDPSKLKPDERDLEDR
VNRMYSTLQLMQTKVNKLLAQQEETRKSIRRRIIEIERFVGEVVEDEEEEEKEETEAEKK
EEEPEKERIEEEKEKEEKKEEEKTKEVTGEEEKREEP
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgacggttgtacctacagcattgggtgtagcagtcccaccccgagtgtctccaataatt
gaggtggaggaggacagcgaaaacccaatttcagctccgactccaggacgagtatttaat
gtcaacaacagcaacaacaacgaggaggaagagaagaaaaagaaaaaagagaaaaaagaa
aagaaggagaaaaaggaaaagaaagagaagaaagaaaagaaggagaagaatcaaaagaac
gagaagcaaaaagataatgagaaagaaaaggaaaaagaaaaagagaaggagaaggaaaaa
gaaaaggagaaggaaaaagaaaaggagaaagaaaaggaaaaggagaaagaaaaggaaaag
gagaaaaaggaagggcccaaggaggtgtttgtgattaaccccgcgggacttctgtactat
cagtggctgctcataatcacattccctgtcatgtacaattggacagttataattgcacga
gcttgttttgaggagcttcagcatgaatatctactgacgtggttcctcctggactacacc
tctgacctgctttacttggctgatatggcattcagagcacgaacaggttacctggaacag
ggcctgcttgtcaaagacgagaagctcctcctcaagcgctacaccgacagtctccagttc
cgcctcgatgtcatctctatgctacccacagacatcttttactttattttggggttggac
tacccagaaatccgcataaacaagttgctccggctgaaccgcatgtttgagttcttcaaa
atctctgaaaccatgaccaactaccccaacatcttccgcatctgcactctggtcatgtac
atcatcatcatcatccactggaacgcctgcctctacttctccttctccaagtctattggg
ttcggctcggatgcatgggtgtatcctgctctcaccgagcctgagtttggagagctcatg
cggaaatattccttcagcctctactggtccacacttactctcaccaccattggagaaacg
ccatctccagagctcgactctgagttcttcttccatgtagttgacttcctggttggcgtc
ttgatctttgccaccattgtaggtaacattgcaacaatgatctcaaatatgaacgcagcc
caggctcagttccaggctaggattgataatattaagcagtacatgcatgcacggcatgtc
agcaaggagcttgaggaccgggttatcaagtggtttgactacctgtggacaaacaagaaa
gcacaagatgagcgagaagtactgaggtacttgccagacaagctaagagcggagattggc
atgaacgtacacttggatacactcaagaaagtgcgtatttttgcagactgtgaggccggg
ttgctgattgagttggtgttgaaacttcgccctcaagttttcagccccggggactacatc
tgtcgaaaaggtgacatcggtcgtgagatgtacatcataaaggatggcaaacttgctgtg
gtggcagatgatggtgtgactcagtttgttgttcttggcgatggaagctactttggagaa
atcagtattctgaacatcaagggcagcaaagcaggaaaccgaaggacggctaatattcga
agcattggctactcagacctcttctgtctgtccaaagacgatctgatggaggctttgacg
gaatatccagatgccaaggctatgctggaggagaaagggaggcagattctgttgaaggat
ggtctgctggagctggacccttcaaagctgaagccggacgagagggatttggaggaccgc
gtcaaccggatgtacagcacactacagctcatgcagaccaaggtgaacaagctgttggca
caacaagaggagacgcggaagagtatcagacggcgaatcattgagattgaacgctttgtt
ggggaggtggtggaggatgaagaggaggaagagaaggaagaaacagaggcagaaaagaaa
gaggaagaaccagagaaagagaggatagaggaagagaaggaaaaggaggaaaagaaagag
gaggagaagacaaaggaagtgaccggagaggaagagaaacgtgaggagccatag

KEGG   Danio rerio (zebrafish): 568211
Entry
568211            CDS       T01004                                 
Symbol
cngb1a
Name
(RefSeq) cyclic nucleotide-gated cation channel beta-1 isoform X10
  KO
K04952  cyclic nucleotide gated channel beta 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    568211 (cngb1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    568211 (cngb1a)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   568211 (cngb1a)
SSDB
Motif
Pfam: cNMP_binding Pyr_redox_3
Other DBs
NCBI-GeneID: 568211
NCBI-ProteinID: XP_005159301
ZFIN: ZDB-GENE-050419-164
Ensembl: ENSDARG00000068242
UniProt: A0A8M2B661
Position
18:45456638..45520019
AA seq 761 aa
MTLPKIIVPPESDSMTLTVPGANLTARSKVVDSESKPEDLEEAVPGGEDEEGKMDVNKSD
LLNVDEGLERPMSAASQTSIVVHERLQELVKLFKGRTERRRDKLVDPDESDDESPSASPA
KKPGEAPPPPPPPEQKKEAEEKPVEEEEEEVQIYEFMGYKIPVPQFKIPQMPEWLRAILA
YRFPSSIDPYTDLIYVVWLFFVTFAWNWNVWLIPVRCTFPYQTPDNIHWWLLMDYFCDSI
YIMDIFVVQPRLQFVRGGDIVCDKNDMRENYRQTERFKMDVISLFPLDVLYVFTGVKSLL
RFPRLLKYNAFFEFNDRLEAWMSKAYIYRVIRTSAYLLYSLHCNACIFYWGSDYEGLGST
KWVYNGKGNSYIRCYYFAVKTLITIGGLPDPTTVFEIVFQLVNYFVGVFAFSIMIGQMRD
VIGAATAGEAYYRHSVDSTVKYMTSYRIPRDVQNRIKTWYDYTWKSQGMLDEQELLIQLP
DKMRLDIAADVNYSIVSKVALFQGCDRQMIFDMLKRLKSVVYLPGDFVCEKGEIGREMYI
IKAGEVQVVGGPDGKTVFVTLRAGSVFGEISLLAGGGGNRRTANVKAHGFANLFILDKKD
LAEILVHYPESQKLLRKKAKKMLTKDKKPAEAKGEVKDTGEVIPQRPETPKLYKAALEVA
TGQTFSRLKEAYKGATLEPSTPISGMSSTGPVPPPSPMHRRSPIPRPQILDEDDMVSETT
DSTVIIRMTPRVEGEEILSVEISPAEGAEAEMEEPQKTEDK
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgacccttcccaaaatcattgtcccgccagagtcagattcaatgaccctcactgttcct
ggagcaaatctcacagcccgcagcaaagttgtggattcagaaagcaaaccagaagatcta
gaggaggcagttcctgggggagaagatgaagaaggcaaaatggatgtgaacaagtctgat
ctgctgaatgtggatgaaggccttgagcgtcccatgtcagcagccagtcaaaccagtatc
gttgtgcatgagcgtctgcaggagctggtcaagctgtttaagggccgaactgaacgtaga
cgagacaaactggtggatccagatgagtctgatgatgaaagcccttcagcatctccagcc
aagaagcctggcgaagcgccgcctccaccacctccaccagagcagaagaaagaggctgaa
gagaagcctgtggaggaggaagaggaggaagtgcagatctatgagttcatgggctacaag
atcccagttccccaattcaaaatcccccagatgcctgagtggctgagagccattctggca
taccgcttcccctccagcattgacccttacactgatctgatctacgtggtgtggctgttc
ttcgtgacgtttgcgtggaactggaatgtttggctgattcctgtgcgctgcactttcccc
tatcagacgcctgacaacattcactggtggctgctgatggactacttctgtgactccatc
tacatcatggacatcttcgtggttcagccacgactgcagttcgtcagaggaggagacatt
gtgtgcgacaaaaacgacatgagagagaactacaggcaaacagagcgatttaagatggat
gtgatcagtctctttccactggatgtcctctatgtcttcactggtgtcaaatctctctta
cggtttcctcgtcttctaaagtacaacgcgttcttcgagtttaatgatcgtctggaggct
tggatgagcaaagcctacatttacagggtgatccgtacaagtgcgtatctgctgtactct
ctgcactgcaatgcctgtattttctattggggctcggactatgagggactgggctccacc
aaatgggtttataatggcaaagggaacagttacatccgctgctattacttcgctgtcaag
actctgatcaccatcggaggtttgccggaccccaccactgtctttgaaattgtctttcag
ctggttaactacttcgtgggggtcttcgctttctccattatgatcggtcagatgagagac
gtgatcggagccgctacagcaggagaagcgtattatagacactctgtggacagcactgtc
aaatacatgacctcctacaggatcccccgcgacgtccagaaccgcattaagacttggtat
gactacacctggaagtctcagggcatgctggatgaacaggagctgctcatacaactgcca
gataagatgcgtttggacatcgctgctgatgtcaactacagcatcgtcagtaaggtggcg
ctctttcagggatgtgaccgacagatgatattcgatatgctcaagaggttgaaatctgtg
gtgtatcttccaggagactttgtctgtgaaaaaggagagatcggccgagagatgtacatc
atcaaagctggagaggtgcaggtggtcggagggcctgatgggaagacggtgtttgtgact
ctgagagctggctctgtgtttggggaaatcagtttgctggcaggtggtggtggaaaccga
cgaacagctaatgtaaaagcgcatggtttcgctaacctcttcatcttggacaagaaggac
ctggcagagatcttagtgcactatcccgaatcccagaaactgctgcgcaagaaggccaag
aagatgttgaccaaagataagaagcctgcagaagcgaagggcgaggttaaagacacgggt
gaggttattcctcagcggcccgagactcccaaactctacaaggcagccctagaggtcgcc
acaggacagacgttttcccggctgaaggaggcttataagggagcaactctagagccgtcc
acccctatatccggcatgagctccacaggtccagtgccgccaccatcccccatgcaccgc
cggtcccccattccccggcctcaaattctagatgaagacgacatggtgtccgagaccacc
gacagcaccgtgatcattcgcatgactccccgcgtggagggagaggagattctgtctgtg
gaaatcagtcctgcggagggagcagaagcagagatggaggagccccaaaaaactgaagac
aagtga

KEGG   Danio rerio (zebrafish): 572249
Entry
572249            CDS       T01004                                 
Symbol
cnga1
Name
(RefSeq) cGMP-gated cation channel alpha-1
  KO
K04948  cyclic nucleotide gated channel alpha 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    572249 (cnga1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    572249 (cnga1)
Ion channels [BR:dre04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   572249 (cnga1)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding SpoIIIAH CDC45 Sec62 HNOBA DUF3043 NPR3 DUF5308 Neur_chan_memb Menin
Other DBs
NCBI-GeneID: 572249
NCBI-ProteinID: XP_701036
ZFIN: ZDB-GENE-110408-39
Ensembl: ENSDARG00000012125
UniProt: A0A8N7T8Q4 E7FE78
Position
23:43849133..43866393
AA seq 639 aa
MSARVRPLDPPRFLVEGMEQVTMEDVIENKRPDAGALFNNTNNSNNNEEEDKKKKKKEKK
EKKEKKEKKEKKEKKEKKKEQEEKEKEKEKEKEKEKEKEKEKEKKEPLKEIEVVDPAGNM
YYNWLFVITCPVMYNWIFIIARACFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYL
EQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYLYFGMNYPEIRMNKLLRINRLFEF
FQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPDPSDPEFGR
LVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNAN
AARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAE
IAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKL
AVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEA
LTEYPDAKAMLEEKGRQILMKDNLLDLELAKQGPDPKDMEEKVQKIGGVLEDLQTRFARL
LAEQEAAQGKLKKRVTKLEKKMTSETLMEPPPETADKTD
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgtctgcacgagtgaggcctttggacccgcccagatttctggtggaggggatggagcag
gttaccatggaggacgttatagaaaataagcgtcctgatgctggagctctcttcaacaac
accaacaacagcaataacaatgaagaggaggacaaaaagaagaaaaagaaagaaaaaaag
gagaaaaaggagaaaaaggagaagaaagaaaagaaggagaagaaggaaaagaagaaagaa
caagaagagaaagagaaggagaaagaaaaagagaaggagaaagaaaaggagaaggaaaaa
gagaaagagaagaaagaaccgctgaaggagatcgaggtggtggatccggctggaaacatg
tactacaactggctgttcgtgatcacgtgtcctgtgatgtacaactggatattcatcata
gcaagagcttgcttcgaggagctgcagggggattatttgatcctctggttcttcctggat
tacttatcggatgcggtgtacctgctggacatggtgttcaggaccaggacaggatatctg
gagcagggtcttctagtgaaagatcagaaaaagcttcgcgatcgctacacagacagcttg
cagtttagactggatctagcctcaatggttcccacagatattttctacctgtacttcggc
atgaactacccagagattcgcatgaacaagctcctgaggatcaatcgactgtttgagttt
ttccagcgcaccgaaacgcggactaactttcccaacgtcttccgaatctccaacctcgtc
atgtacatcgtgatcatcatccactggaacgcctgcatgtattactctttctccaaagcc
atcggttttggatcagacgctttcgtgtacccggacccttcagatcctgagtttggccga
ttggtacgtaaatatgcctacagcatgtactggtccaccctgacgctcactaccatcggc
gaaacaccgccgcccgtcgaaaactctgagtacttcttcgtagtcaccgactttctagtc
ggcgtgttgattttcgcaacaatcgtcggtaacgtcggctcaatgatcacaaatgccaac
gcagcacgagccgatttccaagctcgcatcgatgctattaaacaatacatgagctttcgg
aaagtcaccaaggatttggagaaacgggttattaaatggtttgattatttgtggaccaat
aaaaaggcggtcgatgagagagaagtactgaagtatcttcccgacaagctgagggcggag
atagccataaacgtccatctggatacgctaaaaaaagtgcgtatctttgcggactgtgaa
gccgggcttttggtggagctggtgttaaagctgcagccgcaggtttacagccctggagac
tatatatgcaaaaagggcgacatcgggcgcgagatgtacatcattaaagagggtaaactg
gctgtggtggcggatgacgggattacgcagttcgtggtgctcagtgatgggagttatttc
ggagagatcagcattctcaatattaagggcagcagggcggggaatcgcagaaccgccaac
atacgcagtattggatattcggatctgttctgtctttccaaagacgacctaatggaggcg
ctgactgaatatccggatgccaaggccatgctggaggagaaggggcgacagatccttatg
aaggataatctcctggatttggagttggccaagcagggtcccgatcccaaagacatggag
gagaaggtgcagaagatcggcggtgtgctggaggacctgcagacacgcttcgcccgtctt
ttagctgaacaagaagctgctcagggaaaactgaagaagcgcgtcactaagctggagaag
aagatgaccagcgaaactctgatggagccaccgccggaaactgcagacaagactgactag

DBGET integrated database retrieval system