KEGG   Danio rerio (zebrafish): 100330921
Entry
100330921         CDS       T01004                                 
Symbol
si:ch211-103a14.5
Name
(RefSeq) guanylyl cyclase-activating protein 1-like
  KO
K08328  guanylate cyclase activator 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    100330921 (si:ch211-103a14.5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    100330921 (si:ch211-103a14.5)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100330921 (si:ch211-103a14.5)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 100330921
NCBI-ProteinID: XP_002666176
ZFIN: ZDB-GENE-091204-414
Ensembl: ENSDARG00000100747
UniProt: A0A8M1RRU8
Position
22:1137957..1147351
AA seq 192 aa
MGNAPGTSVEELSACESHQWYRKFMTECPSGQLTFYEFKKFFGLKNLSEKSNEYVMTMFQ
TFDMNDDGCIDFMEYVAALSLILKGGVQQKLRWYFKLYDVDGSGCIDREELLLIVKAIRA
INGVEQEVSAEEFTNMVFEKIDLNADGVLTMDEFMEGIQADEYLSTMLTQSLDLTHIVKK
IYSEIHCEQEPH
NT seq 579 nt   +upstreamnt  +downstreamnt
atggggaacgcgcccggtacatcagtggaggagctcagcgcctgtgagtctcaccagtgg
taccgaaaattcatgaccgagtgtccgtccggccagctcaccttctacgagttcaagaag
ttcttcggcctcaagaatctgtcagagaaatccaacgaatacgtcatgaccatgttccag
acgttcgatatgaatgacgatggctgtattgatttcatggagtatgtggcggctctgagt
ctgatcctgaaaggcggtgttcagcagaagctgcgctggtatttcaagctctacgatgtg
gacggcagcggctgcatcgaccgcgaggagctgctgctcattgttaaggccattcgagcc
attaatggagtcgagcaggaggtttcagctgaagagtttaccaacatggtgtttgaaaag
atcgacctcaatgcagacggagtgttgactatggatgagtttatggagggcattcaggca
gacgagtatctctccaccatgctgactcagagtctggatctcacacacatcgtcaaaaaa
atctacagcgagatccactgtgagcaggagccgcactga

KEGG   Danio rerio (zebrafish): 140430
Entry
140430            CDS       T01004                                 
Symbol
guca1a
Name
(RefSeq) guanylyl cyclase-activating protein 1
  KO
K08328  guanylate cyclase activator 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    140430 (guca1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    140430 (guca1a)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   140430 (guca1a)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 Dockerin_1 EF-hand_9 DUF4845 P21-Arc
Other DBs
NCBI-GeneID: 140430
NCBI-ProteinID: NP_571945
ZFIN: ZDB-GENE-011128-5
Ensembl: ENSDARG00000010454
UniProt: Q90WX4
Position
4:22343102..22350227
AA seq 189 aa
MGNSTGSTVDDLQAVEMHLWYKKFMTECPSGQLTLHEFKQFFGLRGLDPKANAYIEQMFR
TFDMNKDGYIDFMEYVAALSLVMRGKMEHKLRWYFKLYDVDGNGCIDRYELLNIIKAIRA
INGSETQESSAEEFTNRVFERIDINGDGELSLDEFVAGARSDEEFMEVMMKSLDLTHIVA
MIHNRRHSV
NT seq 570 nt   +upstreamnt  +downstreamnt
atgggcaattcaacgggcagcaccgtggacgacctgcaggcagtggagatgcatctgtgg
tataagaagttcatgacagagtgtccatccggtcagctcacgctgcatgagtttaagcag
ttcttcgggctcaggggtctggatccaaaagccaatgcctacatcgagcagatgtttcgc
acctttgacatgaacaaggacggctatatcgactttatggagtacgtggccgctctgagt
cttgtgatgagaggaaaaatggagcacaaattacgctggtatttcaaactctatgatgtt
gatgggaatggatgcatagacagatatgagctgctgaacatcataaaggccattcgtgcc
atcaatggaagcgagacccaggaatcgagcgctgaagagttcacaaatagagtgtttgaa
aggatcgacatcaatggggatggggagctctcgctggatgagtttgtagcaggggctcgc
agtgatgaagaatttatggaggtgatgatgaagagtttggacctcacacacatcgtggcc
atgatccataaccggagacacagcgtttaa

KEGG   Danio rerio (zebrafish): 140431
Entry
140431            CDS       T01004                                 
Symbol
guca1b
Name
(RefSeq) guanylyl cyclase-activating protein 2
  KO
K08328  guanylate cyclase activator 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    140431 (guca1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    140431 (guca1b)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   140431 (guca1b)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg Imm47 SapC
Other DBs
NCBI-GeneID: 140431
NCBI-ProteinID: NP_571946
ZFIN: ZDB-GENE-011128-6
Ensembl: ENSDARG00000013393
UniProt: Q90WX3
Position
23:complement(19227310..19230587)
AA seq 197 aa
MGQRLSDDSDEKEIDVAELQEWYKKFVIECPSGTLFMHDFKSFFGVTENPEAADYIENMF
RAFDKNGDNTIDFLEYVAALNLVLRGKLEHKLKWTFKMYDKDGSGCIDKTELKEIVESIY
RLKKACHGELDAECNLLTPDQVVDRIFELVDENGDGELSLDEFIDGARRDKWVMKMLQMD
VNPGDWINEQRRRSANF
NT seq 594 nt   +upstreamnt  +downstreamnt
atgggtcagcggctcagcgatgattcggacgaaaaagagattgatgttgctgaactacag
gagtggtataagaagtttgtgattgaatgtccgagtggaaccctcttcatgcacgatttc
aagagctttttcggtgttactgaaaacccggaagcagcggattacattgaaaacatgttc
cgggcttttgataaaaatggggacaatactattgattttctggaatacgtggcggccttg
aatctagtgctgcgagggaagttggagcacaaactgaaatggacatttaaaatgtatgac
aaggatggaagcggttgcatcgacaaaacagagctcaaggagattgtggagtcaatctac
agactaaaaaaagcctgccatggtgaactcgatgcagaatgtaacctgcttaccccagat
caggtggtggacaggatatttgagctggtggatgagaacggagatggagagctttctctg
gatgagttcattgacggggctcggcgtgacaagtgggtcatgaagatgctgcaaatggac
gtgaaccccggggactggatcaatgaacagagacgccgcagcgccaacttttga

KEGG   Danio rerio (zebrafish): 373099
Entry
373099            CDS       T01004                                 
Symbol
guca1c
Name
(RefSeq) guanylyl cyclase-activating protein 3
  KO
K08328  guanylate cyclase activator 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    373099 (guca1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    373099 (guca1c)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   373099 (guca1c)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 373099
NCBI-ProteinID: NP_919374
ZFIN: ZDB-GENE-030829-1
Ensembl: ENSDARG00000030758
UniProt: Q8UUX9 F6P7E5
Position
15:complement(2888419..2903626)
AA seq 188 aa
MGAHASNLDEVLAEDMHYWYNKFMRESPSGLITLFELKNMLEMQGMTEEASSYVDQVFFT
FDMDGDGYIDFVEYIAAVSLLLKGEINQKLKWYFKLFDQDGNGKIDRDEMETIFKAIQDI
TRSYEIPPDDIVSLIYERIDVNNEGELTLEEFITGAKEHPDIMEMLTKMMDLTHVLEIIV
NGQKKKKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atgggcgcccacgcatccaacctggatgaggtcttggctgaggacatgcactactggtac
aacaagttcatgagggaatctccgtcaggcttgattacgctgttcgagctcaaaaacatg
ctggagatgcagggcatgacggaggaggccagcagctacgtggaccaggtcttcttcacg
tttgacatggacggggacggctatatagatttcgtggagtacatcgctgctgtaagtctg
ctcctgaaaggagaaatcaaccagaagctgaagtggtacttcaaactcttcgaccaggac
ggaaacggcaagatcgacagagatgaaatggagaccatattcaaggccatccaggacatc
acccggagttatgaaatccctccagatgacatcgtgagcctgatctatgagaggattgat
gttaataacgaaggtgagctgacgcttgaggagttcatcacaggagctaaagagcatcca
gacatcatggagatgctcactaagatgatggacctcacacacgtcctggagatcatcgtc
aacggacagaagaaaaagaaggagtga

KEGG   Danio rerio (zebrafish): 393629
Entry
393629            CDS       T01004                                 
Symbol
guca1e
Name
(RefSeq) guanylate cyclase activator 1e
  KO
K08328  guanylate cyclase activator 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    393629 (guca1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    393629 (guca1e)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   393629 (guca1e)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 393629
NCBI-ProteinID: NP_956950
ZFIN: ZDB-GENE-040426-1577
Ensembl: ENSDARG00000101567
UniProt: Q6PFM5
Position
22:1093001..1107767
AA seq 198 aa
MGDSSSMSATELSACKCHQWYRKFMTECPSGQLTFYEFKKFFGLKNLSEKSNAYVNTMFK
TFDIDDDGCIDFMEYVAALSLVLKGGVQQKLRWYFKLFDMDGSGCIDKDELLLIFKAVQA
INGAEPEISAEDLADMVFNKIDVNGDGELSLEEFMEGISADEKISEMLTQSLDLTRIVSN
IYNDSYIEQEAEIIEDQA
NT seq 597 nt   +upstreamnt  +downstreamnt
atgggggactcctccagcatgtccgccaccgagctcagcgcctgcaaatgccaccagtgg
taccgcaagttcatgaccgagtgtccgtccggccagctcaccttctacgagttcaagaag
ttcttcggcctcaagaatctgtccgagaaatcgaacgcatacgtcaataccatgttcaag
accttcgacattgacgacgatggctgtattgatttcatggagtatgtggcagctctgagt
ctggtcctgaaaggcggtgttcagcagaagctgcgctggtatttcaagctcttcgatatg
gacggcagcggctgtatcgacaaggacgaactgctgctcatcttcaaggcggttcaagcc
attaatggagccgagccggagatctctgcagaggacttggctgatatggtgtttaacaag
attgatgttaatggagacggcgagttgtctctggaagagttcatggagggcatctcggcg
gatgagaagatctcagagatgctgacccagagtttggatctgacccggatcgtgagcaac
atctacaacgactcctacatcgagcaggaggccgagatcatcgaggatcaagcatga

KEGG   Danio rerio (zebrafish): 494572
Entry
494572            CDS       T01004                                 
Symbol
guca1g
Name
(RefSeq) guanylate cyclase activator 1g
  KO
K08328  guanylate cyclase activator 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    494572 (guca1g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    494572 (guca1g)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   494572 (guca1g)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Other DBs
NCBI-GeneID: 494572
NCBI-ProteinID: NP_001011660
ZFIN: ZDB-GENE-050120-1
Ensembl: ENSDARG00000045737
UniProt: A0A2R8Q8G9 Q5MAC7
Position
25:14092978..14096094
AA seq 187 aa
MGQNQSDEEEEEVELTEIQPLYTRFMKVCPSGALHLHEFRRIFGVQSSSEEEALYMETIF
KSFDTNRDNVIDFMEFVAAVHLVLRGNLEDRLKWSFKVYDRDENGKLDRQEVIHVIRILC
KLKKNRINMTPVEICDRIFELLDENNDGQISLSEFLEGAEKDAWIMDLLKLDTNARVWFR
DNLGKKT
NT seq 564 nt   +upstreamnt  +downstreamnt
atgggccagaatcaaagcgatgaagaagaagaagaagtggagctaacagaaatccagcct
ctttacaccagattcatgaaagtgtgtcccagcggagctctgcatctgcatgaatttcgc
aggattttcggcgttcagagctcatcagaagaggaggctttgtacatggagaccatcttc
aagtcctttgatacaaacagggataacgtcatagactttatggagtttgttgccgccgtc
catctcgttttgagaggaaatctggaggacaggttgaaatggtcttttaaagtctatgat
agagatgagaatggaaagttggacagacaagaggttatacatgtcataaggatcctttgc
aagcttaagaaaaacagaatcaacatgactcctgtggaaatctgtgacaggatatttgaa
cttttagatgaaaacaatgatggtcagatctcattgtcggagttcctggaaggggcagaa
aaagatgcctggattatggacctcctaaaactggacaccaatgcacgtgtctggttcagg
gacaacttggggaagaaaacatga

KEGG   Danio rerio (zebrafish): 494573
Entry
494573            CDS       T01004                                 
Symbol
guca1d
Name
(RefSeq) guanylate cyclase activator 1d
  KO
K08328  guanylate cyclase activator 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    494573 (guca1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    494573 (guca1d)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   494573 (guca1d)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 MIF4G
Other DBs
NCBI-GeneID: 494573
NCBI-ProteinID: NP_001011661
ZFIN: ZDB-GENE-040724-231
Ensembl: ENSDARG00000044629
UniProt: A0A2R8QGL2 Q6ZM98
Position
21:complement(22906581..22910436)
AA seq 185 aa
MGNNHASLDDILAEDMHHWYNKFMRESPSGLITLFELKSILGLQGMNEDANSYVDQVFCT
FDMDRDGYIDFVEYIAAISLMLKGEINQKLKWYFKLFDQDGNGKIDKDELETIFTAIQDI
TRNRDIVPEEIVALIFEKIDVNGEGELTLEEFIEGAKEHPEIMDMLKILMDLTPVLLIIV
EGRQK
NT seq 558 nt   +upstreamnt  +downstreamnt
atgggtaacaaccatgccagtctggatgacatcctcgcggaggacatgcaccactggtat
aacaaattcatgagagagtctccgtcaggcctcatcactctctttgagctcaagtctatt
ctggggctgcagggaatgaatgaggacgccaacagttacgtggatcaggtgttctgcact
ttcgacatggacagggatggatatatcgactttgtggagtacatcgctgctattagctta
atgctcaagggagaaatcaaccagaaactcaagtggtacttcaaactttttgaccaggat
ggaaacgggaagattgacaaggacgaattggaaacaatatttacagctatacaagacatc
acaagaaatcgtgacattgtgccagaggaaatagtggcccttatatttgaaaagattgat
gttaacggagagggtgaactgacactggaagagttcatcgaaggagctaaagaacatccc
gaaattatggatatgctgaagatattgatggacctcactccagtcctattaataattgtc
gaagggcgacagaaataa

DBGET integrated database retrieval system