KEGG   Danio rerio (zebrafish): 140424
Entry
140424            CDS       T01004                                 
Symbol
gucy2f
Name
(RefSeq) retinal guanylyl cyclase 2
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    140424 (gucy2f)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    140424 (gucy2f)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    140424 (gucy2f)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     140424 (gucy2f)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   140424 (gucy2f)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA CcmD
Other DBs
NCBI-GeneID: 140424
NCBI-ProteinID: NP_571939
ZFIN: ZDB-GENE-011128-7
Ensembl: ENSDARG00000025504
UniProt: B3DHF2 B3DHH4
Position
15:29359740..29379638
AA seq 1107 aa
MRHIHLPFGGALWQFSSYPCCPVLRSRRSLSTLPFYSITLWIILGVLTFPRCVQCLVFKV
GIIGPWNCDPNYAKSLPAIASRLAVGRINNDFSLDLGCTMDFVILQEACETSKALTSFVQ
YENVADAFVGPTNPGYCNAAALMSKNWDKSLFSWACVNHELDRVQGYPTFARTLPSPLRV
LFNVLKFFRWANIGIVSSNEDIWIDTAAKLASALRNRGLPVGIVTSMGNNDTMLENTLMS
IKNAGDIKVIIMCMHSVLIGGEQQATFLTKAYDMGLASGRYVFIPYDTLLYSLPYINITY
YPLQNNSKLSKAYDAVLTITLDSDIMTFNEAFNAAKQLGELMVTQEPEQVSPLFGTIYNS
LYLLAKSMHNARRAGRWLSGTNLAYFTRNITFTGFNQDIQTDEQGNGQTNYVILDTEAWG
TQLYRCFLVDMTSDLVLFAGRFIHFPGESPPPSDSRCWFEDNAICTGGVDIIYVIIAFVI
VLIIVLGSIGLSLFIRRRIQQIQLIKGPNRILLTLEDLTFINPQLSKRKITLEDLSDSKS
YIEEKSTGDRSRSVNSMATATHETSNVAVYEGDWVWLKKFTEGHFKEVKQSTTKIFTKMK
DLRNENVNPFLGFFTDCEMFAIVTEHCSRGSLHDLLRNDDVKLDWMFKSSLVLDLIKGMK
YLHHREFPHGRLKSRNCVVDGRFVLKITDYGYNEILETQKAPKETLPPEDLFWTAPEHLR
DPESPRKGTYKGDVYSFAIILQEVVVRGAPYCMLGLSPEEIIRKVKKPPPMCRPTVAPDQ
APLECIQLMKQCWSEQPDRRPPFDQIFDQFKLINKGKKTNIIDSMLRMLEQYSSNLEDLI
RERTEELEVEKQRTEKLLSEMLPPSVAEALKTGASVEPEYFDQVTIYFSDIVGFTTISSL
SDPIEVVDLLNDLYSLFDAVLGSHDVYKVETIGDAYMVASGLPKKNGNKHAAEIANMSLN
ILSSVGSFKMRHMPEVPVRIRIGIHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLP
YRIHVNISTVQILRSLNDGYKIDVRGKTELKGKGIEETYWLVGKANFTKPLPNPPEIKPG
DNWQDMMTEEIKSLFRKANRPVDKHKI
NT seq 3324 nt   +upstreamnt  +downstreamnt
atgcgtcatattcacctcccattcggaggtgctttatggcagttctccagttacccttgc
tgccctgtcctgaggagcagacgcagcctctcaacgctgccattctatagcattacacta
tggattattctcggcgtgctgacgtttccacgctgtgtccagtgtctcgttttcaaagta
ggaatcataggcccatggaactgtgaccctaattacgcaaaatcgcttcccgccattgca
tcccgattggctgtcggtcgcatcaacaatgattttagcttagatctgggctgtacgatg
gacttcgtcatccttcaggaggcctgtgagacgtctaaagccctgacctcatttgttcag
tatgaaaacgtggccgatgcatttgtaggccccactaatccaggatactgcaatgcagca
gcactaatgagcaagaattgggacaagtctctattttcgtgggcatgtgttaaccatgag
ttagaccgtgttcagggttacccgacatttgctcggacattaccatccccattacgggtg
ctttttaacgttctgaagtttttcagatgggccaacattgggatagtgtcttctaatgag
gatatatggattgacacagcggctaaattggcgagtgctctcagaaaccggggccttcct
gttggcatcgtcacgtccatggggaataatgacaccatgctggagaacacactgatgagc
atcaagaacgcaggggacatcaaagtcatcattatgtgcatgcactcagtgctcattggc
ggagagcaacaagccactttcctgacgaaggcctatgacatgggtctggcgagcggtcga
tatgtgttcataccatatgacacgctcctgtacagcctgccctacatcaacatcacatac
taccctctgcagaacaacagcaaactgagcaaagcctacgacgcggtgctcactattact
ctagactcagatatcatgacattcaatgaagccttcaatgcggccaaacaactcggagaa
ctgatggtgacacaggagccagagcaggtctctccgctctttggtacaatctacaacagt
ttgtacctcctcgccaagtccatgcacaacgccagaagagccggtcgctggttgtccggg
accaatctggcctatttcaccaggaacattacattcactggcttcaaccaggatatccaa
acagatgagcagggaaacggccagaccaactatgtgattctggacactgaggcctggggc
actcagctgtatcgctgctttctggtggacatgacctcagatttggtgctgtttgctggc
aggttcattcatttccctggagagtcgcctcctccttcagactccaggtgctggtttgag
gacaatgccatctgcactggaggtgtggatatcatatacgtcatcatagcatttgtgata
gttttgattatagttcttggttctattggcctatctcttttcataaggaggcgaatccag
caaatccaactgattaaagggcccaacagaatactgctaacactggaggacctgaccttc
atcaacccacagctcagcaagagaaaaatcacccttgaggatcttagcgactctaaaagt
tacatagaagagaaaagcacaggggatcgatcgcgctctgtaaacagtatggcaactgca
acacatgaaacgtctaatgtagctgtttatgagggtgactgggtttggctgaaaaagttt
acagaggggcatttcaaggaggtcaagcagagcactactaagatttttaccaagatgaag
gacctgcggaatgaaaatgtcaatccatttctggggttcttcaccgactgtgagatgttt
gccattgtcactgagcactgctctcgggggagtctgcatgacctccttcgcaatgatgat
gtcaaactggactggatgtttaaatcctccttggtgctggatctcatcaagggcatgaaa
tatcttcaccacagggagtttcctcatgggcgtctgaagtctcgtaattgtgttgtagat
ggacgttttgtcttaaagatcactgattatggttacaatgagattcttgagacccagaaa
gcaccaaaggagacactgccaccagaggatctattctggacagctcctgaacatctcagg
gatcctgaaagtccacggaaaggaacttataaaggagatgtgtacagctttgcgattata
cttcaagaagttgttgtcagaggagcaccgtattgcatgctcggcctgtcccctgaagag
ataataagaaaggtgaagaaacctccacctatgtgccgacccactgtagctccagatcaa
gctccactggagtgcatccagttgatgaagcagtgctggagtgaacagcctgatagaagg
cctccttttgatcagatttttgatcagttcaagctcatcaacaagggcaaaaagaccaac
attatcgactccatgttgcgcatgctggagcagtactcatccaacctagaagacctgatc
agagaaagaacagaggagctggaggtggagaaacaaaggacagagaagcttctgtctgag
atgcttcctccctctgtggcagaagctctgaaaaccggtgcctccgtggagccagagtac
ttcgatcaagtcaccatctacttcagtgacatcgtaggcttcaccaccatctcatctctc
agtgatccaatagaggttgtagacctgctcaatgacctctacagcctatttgacgctgta
ctgggcagccatgatgtctacaaggtcgaaaccattggagatgcctatatggtggcctct
gggctgccaaagaagaacggcaacaagcacgcagccgagatcgccaacatgtcgctgaac
attctcagctccgtgggctccttcaaaatgcggcacatgcctgaagttccggtcaggata
cggatcggcattcactcagggccgtgtgttgctggagtcgtgggtctaactatgcctaga
tactgcctttttggagacacagtcaacaccgcctctcgtatggaatctacagggttgcct
tacagaattcatgtgaacattagtacagtgcaaattctccgctcactgaatgatggctac
aaaatagatgttcgtggaaagactgagctgaaggggaaaggcattgaagaaacatactgg
cttgttgggaaagctaattttactaagcctttgccaaatccaccagagatcaaaccagga
gataactggcaagacatgatgacggaggagatcaagtcattatttcgcaaggccaacaga
ccagtggacaagcacaaaatctaa

KEGG   Danio rerio (zebrafish): 140425
Entry
140425            CDS       T01004                                 
Symbol
gc2
Name
(RefSeq) retinal guanylyl cyclase 2
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    140425 (gc2)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    140425 (gc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    140425 (gc2)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     140425 (gc2)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   140425 (gc2)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Kinase-like
Other DBs
NCBI-GeneID: 140425
NCBI-ProteinID: NP_001103165
ZFIN: ZDB-GENE-011128-8
Ensembl: ENSDARG00000018329
UniProt: A0A8M1NEV9 E7F111
Position
7:complement(51267545..51297609)
AA seq 1107 aa
MPHPSNAFHSFLPARGTSGLRSPSQMPHFSSDPKHIYLCLLWSTIILCLLPATNAATIKV
GVVGPWSCDPIFTKAQPGVAARLAVAHINKDPYLSQGITFDYIILDEDCETSKSFARFLG
YYTRASGFIGPVNPGYCEAASLLGKSWNKAVFSWSCIEHELDDVRSHPTFARTMPVPSLV
LLSFMRHFRWAHVGIISSSEDVWVEAAIKLANALRSHGLPVGIVTSARNDHTSVRQTLAK
VRKVADLRLVILVMHSVLIGGRTQKLLLETAHDMRMTDGSLVFMSYDTLFYSLPYHHVTQ
PALRYNSKLLRAYDAVLTITIESPKEQSFYQAFEKAQEDGELPKHLKPQQVSPLFGTIYS
SIVFMAHAVQSVRAAGQWMSGGNIAQNARNLLFKGGSSLQANSSDFGMLDYVILDTDGFS
WELQPTYRIEMQTDMVRFLGRHIHFPYAGPPRTDSSCWFTHGIICRGGVNLFHMISMFLL
GFLFIFLSIGCSYCIRRKINKIRLVRGPNKILLTLNDVTFINPSLSNKKLSVDDSKASDT
RMSISERSLVSPMSSQSPATYENSNVAIYEGDWAWMKRLPYGTFRSITPNTSDVFELMKD
LRHENINPFLGFFHDCGVFAIVTEFCSRGSLEDLLVNDDVKLDWMFKSSLILDLIKGMKY
LHHRNVCHGRLKSRNCVVDGRFVLKITDYGYNEVLESQRFPYIEPPAEDLLWTAPEILRG
SYPGLHGTHSGDVYSFSIIMQEVVMRGPPFCMLENTFDEIVQKVRKPPPMCRPIVSPDHA
PMECIQLMKQCWNEQPEKRPTFDEIFDQFKNVNKGKKTNIIDSMLRMLEQYSSNLEELIR
ERTEELEIEKQKTEKLLTQMLPPSVAEALKLGTTVEPEHFESVSLYFSDIVGFTTISANS
EPIEVVDLLNDLYTTFDAVIGNHDVYKVETIGDAYMVASGVPVPNGNRHAAEIANMALDI
LSAVGTFRMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTASRMESTGLPY
RIHVHSSTVKILMELKLGYRVELRARTELKGKRIEETYWLTGRDGFTKPLPVPPVLKSGQ
MAHGLQMEEIAAYKKRKAEAQLAKKKN
NT seq 3324 nt   +upstreamnt  +downstreamnt
atgccacatccatccaatgcctttcacagcttccttccagcacggggcaccagcggactc
cgatcccccagtcaaatgccccatttctctagtgacccaaaacatatctatttatgtctc
ctgtggtcaaccataattctttgcctccttcctgccaccaatgctgccaccatcaaggtt
ggcgtggtggggccatggtcatgtgaccccatctttactaaagcccagcctggcgtggct
gcacgtttggcagtggcacacataaacaaggacccctacctttcacagggcatcaccttt
gattatatcatcctggacgaggactgtgaaacatccaagtcttttgcccggtttctgggt
tattacacacgggcgtctgggtttattggtccggtgaacccaggctactgtgaagctgct
tctctgttagggaagagttggaataaggcagtgttttcctggtcttgtattgaacatgag
ctggatgatgtccgtagtcatcctacatttgcccgcaccatgcccgtcccgtcccttgtg
ctgttgagcttcatgcggcactttcgctgggcacacgtgggcatcatttcatcatctgag
gatgtctgggtggaggcagctataaagctggctaatgccctgcggagtcatggattgcct
gttgggattgtgacgtcggctcgcaatgaccacaccagtgttcgtcagaccctggccaaa
gtcaggaaagtagcagatctccgattggtcatcttggtcatgcactctgtgttaattggt
ggaagaacccagaagctgctgctggaaacggcacatgacatgcggatgacagacggctcg
ttggtgtttatgtcctacgatactctcttttacagtctgccctaccatcacgttactcaa
ccagccctgcgctataacagcaagctgctacgtgcctatgatgctgtgctcacgatcact
attgagtctccaaaggaacagtctttttatcaagcttttgaaaaggcacaggaggatgga
gagttacccaaacacctcaaaccacagcaggtgtccccattatttggcaccatctactcg
tcgatcgtgtttatggctcatgctgtgcaaagtgtcagggctgccggtcagtggatgtcc
ggtggtaacatcgcccagaatgcccgaaacctgttattcaaaggagggtctagcctacaa
gcaaactcttctgactttgggatgttggattatgtgattctggacacagatggcttttct
tgggagttgcagcctacataccgtatagagatgcagacagatatggtgaggtttctgggt
cggcatattcatttcccctacgcaggaccacccagaactgattccagctgctggtttaca
cacgggatcatctgccgtggaggcgtgaatcttttccacatgatttcaatgttcctgctc
gggtttctgttcatctttttgtcgattggctgttcgtactgcatcaggcgtaaaattaat
aagattcgactggtacgaggtccgaacaagattttactgacgttaaatgacgtaacgttc
atcaacccatcgctgagtaataagaagctgagcgtggatgacagcaaggccagtgacacc
agaatgagcatttcagagcgaagcctcgtttctccaatgtccagtcagtcgccagccacc
tacgaaaattctaatgttgccatttatgagggtgattgggcatggatgaagcgacttccc
tatggaaccttccggagcatcactcctaataccagtgatgtatttgaactgatgaaggat
ttgaggcacgagaacattaacccattcctcggcttcttccacgactgcggggtctttgcc
attgtgacagagttctgttcacggggcagtttggaggatctgttggtcaacgatgacgtc
aaactggactggatgttcaagtcctctctcattctggacctcatcaagggaatgaaatac
cttcaccacaggaacgtctgccatggcaggctgaaatccaggaactgtgtggttgatggg
cgctttgtcctcaagatcacagactatggctacaacgaggtgttagaatctcagagattt
ccttatattgaaccaccagctgaagacctgctgtggacggcccctgagatactgagaggg
tcctacccaggtctgcatggcacacattctggcgatgtgtacagcttctcaatcatcatg
caagaagtggtcatgcgagggcctccgttctgcatgctggagaatacttttgatgaaatt
gtccagaaggtccggaagcctccaccaatgtgccgcccgattgtatctccagatcatgct
ccgatggagtgcattcagcttatgaagcagtgctggaatgaacaaccggagaaaagaccc
acatttgatgaaatctttgaccagttcaagaacgttaataaagggaaaaagaccaacatc
atagactccatgttgcgaatgctggagcaatattcctccaacctggaggagctgatcagg
gaaaggacagaggagctggaaatagagaaacaaaagacagagaaactcctgacgcaaatg
ttgcccccgtcagtggcagaggctctgaagcttggcactacagttgaaccagaacatttt
gagagtgtcagcctctatttcagtgatattgttggcttcaccactatctcagccaatagc
gagcccattgaggtagttgacctcctcaatgacctttacacaacctttgatgctgtaatt
ggaaatcatgacgtctacaaggtggagaccattggtgatgcttacatggtggcatcaggt
gtgcccgttcccaatgggaaccgacacgcagctgagattgcaaacatggccctggatatc
ctgagtgctgttgggaccttcaggatgagacatatgcctgatgtcccagtccgcatccga
ataggacttcacacaggtccttgtgtggctggtgtagtaggtttgaccatgccacggtac
tgtctctttggggacaccgtcaccactgcttccagaatggagtctacaggactgccatac
agaatccatgtccattcaagtactgtgaagatccttatggagctgaaattggggtacaga
gtagagctgagagccagaacagaactcaagggcaagcgcatagaagaaacctactggctg
accgggagggacggcttcaccaaaccgctccccgtgccccccgtgctcaagtcagggcaa
atggctcatggcttgcagatggaggagatagccgcatacaagaagcggaaagcagaagca
cagcttgcaaagaagaaaaactga

KEGG   Danio rerio (zebrafish): 140426
Entry
140426            CDS       T01004                                 
Symbol
gucy2d
Name
(RefSeq) retinal guanylyl cyclase 1
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    140426 (gucy2d)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    140426 (gucy2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    140426 (gucy2d)
Enzymes [BR:dre01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     140426 (gucy2d)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   140426 (gucy2d)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Kinase-like CDC13_N
Other DBs
NCBI-GeneID: 140426
NCBI-ProteinID: NP_571941
ZFIN: ZDB-GENE-011128-9
Ensembl: ENSDARG00000026820
UniProt: F1QSL9 A5PLH7 A0A8M1P9F3
Position
5:complement(38122854..38161108)
AA seq 1137 aa
MNDHTSFLCQSHHPRWQTQSSAGKRRRKQSSSQKSETPASPVSSSPVLRSHSWWGNCFLL
PLVMLSYFPCEAWGTTFKIAIVGPWACDPMYSKALPDLAARLAMSRINKDPELNKGYWYD
YTVINEDCSSSRGLARFAELEGYGSAFLGPANPGYCTAATLLAKNWNKGILSWGCLKAEM
DEEMYPTFLRPLPLSSRVLFSVLRFFRWAHVGIVTAEGDMWEATGHELAASLRALGLPVG
KVVTMEQDKEGPRQALQAIRDTDRVRVVIMCMHSALIGGEEQYQLLTTALEMRMIDRGYI
FIPYDTLLYSLPYENVKYPILANDSKLRRAYDGVLTVTMDQGEQNFYEAFNAAQESFEIR
GSTSAEEVSPFFGTIYNMIYYTAMAAEQSRASSGGRWVSGDLLSQNEGGFEFDGFNQRIS
GGTNGEGMQVRYAVLDSDGSGSSLYRTHALEASHTYGKYGGLKYLGKSIHFAGASPSSDA
NCWFSPYIACSGGLDGVTLFFLLMFFIVLIAGAGILFLQVRKYGAGGFFGAFIGGGGSPT
KIVLTLDDLVFINTTLSRRKLNDESMLKSQLDVKTPRHSVSGRSYITSTPETSNVAVFEG
DWVWLKKCPCADSITEISESTQTIFVKLRDMRHENLNLFLGLFMDTGIFGIVTEHCTRGS
LEDLLNNEEMRLDWMFKSSLLLDLIRGMKYLHNRGIIHGRLKSRNCVVDGRFVLKVTDYG
FNEILNCQNIILEDNAPEDQFWTAPEILRNPDLKKKGTYPGDVYSFSIIMQEVISRCAPF
CMLDMPPEEIIEKVRSPPPLCRPTVSMDEAPLDVIQLMKQAWSEEPEQRPTFEDIFRQFK
SMNKGKKTNIIDSMLRMLEQYSSNLEDLIRERTEELEVERQKTDALLAQMLPKSVALALK
TGKPVKPEHFAEVTLYFSDIVGFTTISALSEPIEVVDLLNDLYTHFDGIIAIHDVYKVET
IGDAYMVASGVPNRNGTRHAAEMANMSLDILHCIGTFKMRHMPDVKVKIRIGLHSGPVVA
GVVGLKMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTVDVLNSLKLGYKIDTRGRTELK
GKGVEETFWLVGRDGFDKPLPIPPDLTPGASNHGISLDEIPTDRRQKFLDRQKRMGN
NT seq 3414 nt   +upstreamnt  +downstreamnt
atgaatgaccacacaagctttctctgccagtcccaccaccctcgatggcaaacacagtct
tctgctggaaagagacgacggaaacaatcctcatcgcaaaaatctgaaaccccagcgagc
ccagtgtcctcgtccccagtgctacgcagccacagctggtggggaaactgctttctcctt
cctctagtcatgctttcatactttccctgtgaagcctggggcaccaccttcaaaattgcc
attgtaggaccgtgggcatgtgaccccatgtactctaaagccctgccagatctggctgcc
cgattagccatgagccgcatcaacaaagaccccgaactcaataaaggctactggtatgat
tacacagtcattaacgaggattgctccagctccagaggcctggcacgctttgccgagctg
gagggttacggttcggcttttctaggaccggcaaaccctggctactgcacggctgccaca
ctgctggcaaagaactggaacaaaggcatcctatcctggggttgcctgaaggctgagatg
gatgaagagatgtatcccacctttctgcggccgctgccgttgtcctcccgggtgcttttc
tctgtgctgcggttcttccgttgggcacatgttgggattgtaactgctgagggcgacatg
tgggaggcaactgggcatgagcttgcagcatccctgcgtgctcttggcttgcccgttggt
aaggttgttacgatggaacaggacaaagaggggccacggcaagccctacaggcaatacgg
gacacagatcgagtaagggttgtcatcatgtgcatgcactctgccctgattggtggagag
gaacagtatcagttgctgactacagcattggaaatgagaatgattgaccgagggtacatc
ttcattccatacgacaccctgctctattcactgccatatgaaaatgtaaaatatccaatc
ctggccaatgacagcaaactgcgacgagcatacgatggggtcttaacagtaaccatggac
caaggggaacaaaacttttatgaggcctttaatgcagcacaggaatcctttgaaatccgc
ggcagcacatcagctgaagaggtttctccattttttgggaccatatataacatgatctat
tatacagccatggctgcagagcaaagccgagcttcgagtggtgggcgatgggtatcgggc
gatttactgtctcaaaacgagggtggatttgaatttgatggctttaaccagcggatatcg
ggaggtactaacggagagggaatgcaggtccgctatgctgtcctggattcagacggctct
gggtccagcctgtatcgcacacacgccctggaagcttcacacacatatggaaaatatgga
gggttaaaatacttggggaagtcaattcattttgctggagcgtctccgagcagtgacgcg
aactgctggtttagtccttatatcgcatgtagtggaggattggatggagtgacgcttttc
ttcttgctcatgtttttcatagtgttgatagcgggtgcaggcatcctttttctacaagtt
agaaaatatggggctggaggtttttttggtgcgtttattggaggaggaggaagccccact
aagatagtgctgacgctggatgacttggtcttcatcaacaccacactcagcagaaggaaa
ctgaatgacgagagtatgctgaagagtcagctagatgttaaaaccccgcgccactcagtc
tctggtcgcagttacatcacatcaaccccagaaacatccaatgttgctgtatttgagggt
gactgggtctggttaaagaaatgcccctgtgcagattctattacagagatcagtgaaagc
acacagaccatctttgtcaagctgagagatatgcgtcatgagaatctgaacttgttcctg
ggtctgtttatggatactggtatattcggcattgttacagagcactgcaccagaggcagt
ctggaagacctgctcaacaatgaggaaatgaggcttgactggatgttcaaatcctctctt
ctcctcgacctgattaggggaatgaagtacttgcataatcggggcattattcatggacgc
ctgaagtctcggaactgtgtggtggatggtcgatttgttttgaaggttacagattatggc
ttcaatgaaatcctcaactgccaaaacatcatcctggaggacaacgcaccagaggatcag
ttctggacagctccggagatcctgaggaatcctgatctgaagaagaagggaacatatcca
ggagatgtatacagcttttctatcatcatgcaggaggtgatctctcgctgcgcacccttc
tgcatgttggatatgcctcctgaagaaatcatagaaaaggtgcgctctcctccaccactg
tgccgacccactgtgtctatggatgaagctccgctagatgtgattcagctcatgaagcag
gcctggagtgaggagcctgaacagaggcctacgtttgaggatatattcagacagtttaag
agcatgaacaaaggaaagaagactaacataatagactcaatgttgaggatgctggagcag
tactcctcaaacctggaggatctgatccgagagaggaccgaagaactggaggtagagcga
cagaaaactgatgctcttctagcccagatgctgcccaagtcggtggccttggcattaaaa
acagggaagccagtgaagccagagcatttcgctgaagtcacactgtatttcagtgatatc
gtgggtttcaccaccatctctgccctcagtgaacccatcgaagtggtcgatctgcttaat
gacctctacacacactttgatggaatcatcgctatccacgatgtctataaggtggagact
attggtgatgcgtacatggtggcatcaggagttcccaatcgcaatggtacccgccacgct
gcagagatggccaacatgtccctggacattctccactgcatcggtacatttaaaatgagg
cacatgcctgacgtcaaagtcaaaattcgcattggactacattctggtccagtggtcgca
ggtgtagttggcttaaagatgcctcgatactgtctgttcggggacacagtaaacacagcc
tcccgaatggaatccacagggttgccttacagaattcatgtcaaccagagtacagttgat
gtcctaaacagtctcaaacttggctacaaaatagatactcggggcaggaccgagctcaag
ggtaaaggtgtagaagaaacattttggttggttgggagggatggatttgacaagccgtta
cctataccgccagaccttactcctggggcgagcaaccatggtatcagcttggatgagatc
ccgactgataggcgacagaaattcttggatcgacagaagaggatgggcaattga

DBGET integrated database retrieval system