KEGG   Danio rerio (zebrafish): 140428
Entry
140428            CDS       T01004                                 
Symbol
gnat1
Name
(RefSeq) guanine nucleotide-binding protein G(t) subunit alpha-1
  KO
K04631  guanine nucleotide-binding protein G(t) subunit alpha 1/2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    140428 (gnat1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dre04031]
    140428 (gnat1)
GTP-binding proteins [BR:dre04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    140428 (gnat1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB DAP3 AAA_29
Other DBs
NCBI-GeneID: 140428
NCBI-ProteinID: NP_571943
ZFIN: ZDB-GENE-011128-11
Ensembl: ENSDARG00000044199
UniProt: F6NX22 Q90WX6
Position
6:42919017..42930302
AA seq 350 aa
MGAGASAEEKHSRELEKKLKEDADKDARTVKLLLLGAGESGKSTIVKQMKIIHKDGYSLE
ECLEFIVIIYSNTMQSILAVVRAMTTLNIGYGDAAAQDDARKLMHLADTIEEGTMPKELS
DIILRLWKDSGIQACFDRASEYQLNDSAGYYLNDLERLIQPGYVPTEQDVLRSRVKTTGI
IETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMH
ESLHLFNSICNHRYFATTSIVLFLNKKDVFVEKIKKAHLSMCFPEYDGPNTFEDAGNYIK
VQFLDLNLRRDIKEIYSHMTCATDTENVKFVFDAVTDIIIKENLKDCGLF
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgggggccggggcgagcgccgaggaaaaacactccagggagcttgagaaaaagctgaaa
gaggatgcagacaaagatgccaggaccgtcaaacttctgctgctaggtgctggtgagtcg
gggaaaagcacaattgtcaaacagatgaaaattattcacaaagatggttactcccttgaa
gagtgcttggagttcattgtcatcatctacagcaacaccatgcagtccattctggccgtt
gtgagggccatgaccacactcaacattggctatggagacgctgccgcacaggatgatgca
aggaagctgatgcatttagcagatactattgaagagggcaccatgccaaaagagctgtcg
gacattatcctgaggttgtggaaggattcaggcatccaggcgtgcttcgacagagcctca
gaataccagctcaacgactctgctggatattatctaaatgacctggagaggttgatccag
cccggctatgtccctactgaacaggacgtcctgcgttcaagagtgaagaccacaggtatc
atcgagacccagttctctttcaaagacctcaacttcaggatgtttgatgtgggtggtcag
cgctcagagaggaagaagtggattcactgctttgaaggtgtgacctgtatcatcttcatc
gctgctctgagtgcatacgacatggtgctggtggaggatgatgaagtgaaccgaatgcat
gagagtcttcacctgttcaacagtatctgcaaccaccgttacttcgccaccacatctatt
gtgcttttccttaacaagaaggatgtgttcgtggagaagatcaagaaagctcatctgagc
atgtgcttccctgaatatgacggtcccaacaccttcgaagatgctggcaactacatcaag
gtgcagttcttagatctgaacctgcgacgagacatcaaagaaatctactcccacatgacc
tgcgccacagacacagagaacgtcaagtttgtgttcgatgccgtaacagacatcatcatc
aaggagaatctcaaagactgcggtctcttctaa

KEGG   Danio rerio (zebrafish): 140429
Entry
140429            CDS       T01004                                 
Symbol
gnat2
Name
(RefSeq) guanine nucleotide-binding protein G(t) subunit alpha-2
  KO
K04631  guanine nucleotide-binding protein G(t) subunit alpha 1/2
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    140429 (gnat2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dre04031]
    140429 (gnat2)
GTP-binding proteins [BR:dre04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    140429 (gnat2)
SSDB
Motif
Pfam: G-alpha Arf DAP3 TniB AAA_29
Other DBs
NCBI-GeneID: 140429
NCBI-ProteinID: NP_571944
ZFIN: ZDB-GENE-011128-10
Ensembl: ENSDARG00000042529
UniProt: Q90WX5 F6NNY3
Position
8:complement(25225590..25235603)
AA seq 354 aa
MGSGASAEDKEMAKKSKELEKQLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKILHQGG
YTKEEQMEFRSIIFGNILQSALAIIRGMEMLSINFGSPSAQEDSQKLQNLSDSIEEGTMP
PELADVIKRLWKDAGVQASFDRAAEYQLNDSAGYYLNEMDRICKPDYLPTEQDVLRSRVK
TTGIIEEQFGCKELHFRMFDVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDDEV
NRMHESLHLFNSICNHRFFATTSIVLFLNKKDLFQEKIKKVHLSICFPDYDGPNTYEDAS
NYIKTQFQDLNMKKGVKEIYSHMTCATDTKNVEIVFNAVTDIIIKENLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggtagcggagcgagcgcagaggataaggaaatggccaagaagtccaaagagctggaa
aagcagctccaggaagatgccgataaggaagccaagacggtcaaacttctgctgctgggt
gctggtgaatcagggaagagcaccattgtaaaacagatgaagattctccatcaaggtggt
tatacaaaagaagaacaaatggagtttcgatctattatttttggcaacatcctgcagtct
gctctggccatcatcaggggcatggagatgctgtcaatcaactttggatcgccatctgca
caggaggatagtcaaaagctccagaacctgtctgactccattgaggagggcaccatgcct
ccagagctggcagacgtcatcaaaaggctatggaaggatgcaggcgtgcaggcctctttt
gatagagctgccgagtaccagctgaacgactctgctggatactacttgaacgaaatggac
agaatctgcaaacctgactaccttcccaccgagcaggatgtgctgagatctcgagtcaag
accactggtatcattgaggaacagttcggttgcaaagagctccactttaggatgtttgat
gtgggtggccagaggtccgagaggaagaaatggattcattgtttcgaaggtgtgacttgc
atcatcttctgtggagctcttagcgcttatgacatggtgctggtagaagatgatgaagtg
aaccgcatgcacgagagtctccatctcttcaacagtatctgcaatcacagattcttcgcc
acaacttccattgtgcttttcctcaacaagaaagatctcttccaggagaagattaagaag
gtccacctgagcatctgcttccctgactatgatggtccaaacacatatgaagatgcaagc
aactacatcaagactcaatttcaagacctgaacatgaagaagggagtgaaggagatctac
tcacacatgacctgtgccacggacacaaagaacgtcgagattgtgtttaacgccgtgaca
gacattatcatcaaagaaaaccttaaggactgcggtctgttctaa

KEGG   Danio rerio (zebrafish): 322104
Entry
322104            CDS       T01004                                 
Symbol
gnb1a
Name
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
  KO
K04536  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04371  Apelin signaling pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    322104 (gnb1a)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    322104 (gnb1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    322104 (gnb1a)
   04031 GTP-binding proteins [BR:dre04031]
    322104 (gnb1a)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   322104 (gnb1a)
  Exosomal proteins of colorectal cancer cells
   322104 (gnb1a)
  Exosomal proteins of melanoma cells
   322104 (gnb1a)
GTP-binding proteins [BR:dre04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    322104 (gnb1a)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 WD40_like eIF2A CaM_bind DUF4407
Other DBs
NCBI-GeneID: 322104
NCBI-ProteinID: NP_997774
ZFIN: ZDB-GENE-030131-823
Ensembl: ENSDARG00000090454
UniProt: Q6PH57
Position
8:53269657..53331655
AA seq 340 aa
MSELDQLRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF
AGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDAL
KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagcgaactcgaccagttacgtcaggaggctgaacagctgaaaaaccagatcagagat
gcgcggaaagcatgtgcggatgccaccctctctcagatcacagctaatattgatcctgtt
gggcggattcagatgcgcactagacggacactgaggggacacttggcgaagatctacgcc
atgcactggggcactgactcaaggcttcttgttagtgcttcccaggatggaaaacttatt
atctgggacagctatactacaaacaaggttcatgccatcccgctgcgctcctcgtgggtg
atgacctgtgcgtacgcgccgtccgggaactacgtggcatgcggaggtttggacaacatc
tgctccatctacaacctgaagacccgcgaggggaacgtgcgcgtcagccgcgagctagcc
ggacacacaggttatctgtcctgctgtcgtttcctggatgataaccagattgtgaccagc
tcaggcgacaccacctgtgctctgtgggacatcgagacgggccagcagacgaccacgttc
gcgggtcacaccggtgatgtgatgtcactgtctctggctccagacactcgtctgttcgtt
tcgggcgcctgcgacgcctccgctaaactgtgggacgtcagagaaggcatgtgcagacag
accttcaccggccacgagtctgacatcaacgccatctgttttttccccaatggcaatgcg
ttcgccacgggctcagacgacgccacctgcaggctgttcgacctgcgcgcggatcaggag
ctgatggtctactctcacgacaacatcatctgtgggatcacctccgtggccttttccaag
agcggacgcctgctgctcgccggatacgacgacttcaactgcaacgtgtgggacgctctc
aaagccgaccgcgcaggtgttttggcgggtcatgataatcgcgtcagctgcttgggcgtc
actgatgatggcatggctgtggccacaggatcctgggatagtttccttaagatctggaat
taa

KEGG   Danio rerio (zebrafish): 335656
Entry
335656            CDS       T01004                                 
Symbol
gngt1
Name
(RefSeq) guanine nucleotide-binding protein G(T) subunit gamma-T1
  KO
K04548  guanine nucleotide-binding protein G(T) subunit gamma-T1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04371  Apelin signaling pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    335656 (gngt1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    335656 (gngt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:dre04031]
    335656 (gngt1)
GTP-binding proteins [BR:dre04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    335656 (gngt1)
SSDB
Motif
Pfam: G-gamma
Other DBs
NCBI-GeneID: 335656
NCBI-ProteinID: NP_956261
ZFIN: ZDB-GENE-030131-7596
Ensembl: ENSDARG00000035798
UniProt: F6P4M1 Q6PBN9
Position
19:40856729..40859461
AA seq 73 aa
MPIIDVENMTDLDKAKMEVTQLKTEVKLERAKVSKCCEEITEYIQGGADEDPLVKGIPEE
KNPFKEKGGCVIC
NT seq 222 nt   +upstreamnt  +downstreamnt
atgccgatcatagatgtagaaaatatgactgacctggataaggcgaagatggaagtaacc
cagctcaaaactgaggtgaagctagaaagggcgaaggtgtccaaatgctgtgaagagatt
acagagtacattcaaggaggagcggatgaagatcctctggtcaaaggcattccagaggag
aagaacccgttcaaggagaaaggtggatgtgtcatttgctaa

KEGG   Danio rerio (zebrafish): 406796
Entry
406796            CDS       T01004                                 
Symbol
gnb1b
Name
(RefSeq) guanine nucleotide binding protein (G protein), beta polypeptide 1b
  KO
K04536  guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04371  Apelin signaling pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    406796 (gnb1b)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    406796 (gnb1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    406796 (gnb1b)
   04031 GTP-binding proteins [BR:dre04031]
    406796 (gnb1b)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   406796 (gnb1b)
  Exosomal proteins of colorectal cancer cells
   406796 (gnb1b)
  Exosomal proteins of melanoma cells
   406796 (gnb1b)
GTP-binding proteins [BR:dre04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    406796 (gnb1b)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 WD40_like eIF2A CaM_bind DUF4407
Other DBs
NCBI-GeneID: 406796
NCBI-ProteinID: NP_998646
ZFIN: ZDB-GENE-040426-2855
Ensembl: ENSDARG00000104372
UniProt: A7YYJ4 Q803H5
Position
6:complement(53304977..53334194)
AA seq 340 aa
MSELDQLRQEAEQLKNQIRDARKACADATLSQITANIDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYSLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF
AGHTGDVMSLSLAPDTRLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTL
KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagtgaactggaccagttacgccaggaggctgagcagctgaagaaccagatcagagat
gcaaggaaagcttgtgcagatgccacactatcacagatcacagccaacatcgaccctgtt
ggccgaatccagatgcgcacaagaagaacactgcgagggcatttggctaaaatctacgcc
atgcactggggcaccgattccaggctgcttgtcagtgcttcccaggatggaaaactcatt
atttgggacagttataccacaaataaggtccacgccattcctctgcgctcctcctgggtg
atgacctgtgcctacgctccttcagggaattacgtcgcttgcggaggcctggacaacatc
tgctccatctacagcctcaagactcgtgaggggaacgtgcgcgtcagtcgtgagctggcc
ggacacacaggatacctctcttgctgccgcttccttgatgacaaccagattgtgacaagt
tctggcgacaccacctgtgctctctgggacattgagaccggtcagcagacgaccacgttt
gcgggtcacactggagatgtgatgagtctgtctctggctccagacaccaggctgtttgtg
tccggggcctgcgacgcctccgctaaactctgggacatccgtgagggcatgtgcagacag
accttcaccggccacgagtctgacatcaacgccatctgtttcttcccgaacggcaatgct
ttcgccactggctctgacgatgccacctgccgtctgtttgacctgcgcgctgaccaggag
ctcatggtttactctcacgacaacatcatctgcggtataacctcggtggccttctccaag
agcggtcgcctgctgctcgccggctacgacgacttcaactgcaacgtttgggacacccta
aaggccgaccgcgctggtgtgctggcgggtcacgataacagagtaagctgtctgggtgtc
accgatgatgggatggcagtggctacagggtcctgggacagtttcctcaagatctggaac
tga

DBGET integrated database retrieval system