KEGG   Danio rerio (zebrafish): 30295
Entry
30295             CDS       T01004                                 
Symbol
rho
Name
(RefSeq) rhodopsin
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    30295 (rho)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    30295 (rho)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    30295 (rho)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srw 7TM_GPCR_Srx TAS2R 7TM_GPCR_Srh 7TM_GPCR_Sru DUF92 CitMHS TctB FA_desaturase
Other DBs
NCBI-GeneID: 30295
NCBI-ProteinID: NP_571159
ZFIN: ZDB-GENE-990415-271
Ensembl: ENSDARG00000002193
UniProt: P35359
Position
8:complement(54076192..54077740)
AA seq 354 aa
MNGTEGPAFYVPMSNATGVVRSPYEYPQYYLVAPWAYGFVAAYMFFLIITGFPVNFLTLY
VTIEHKKLRTPLNYILLNLAIADLFMVFGGFTTTMYTSLHGYFVFGRLGCNLEGFFATLG
GEMGLKSLVVLAIERWMVVCKPVSNFRFGENHAIMGVAFTWVMACSCAVPPLVGWSRYIP
EGMQCSCGVDYYTRTPGVNNESFVIYMFIVHFFIPLIVIFFCYGRLVCTVKEAARQQQES
ETTQRAEREVTRMVIIMVIAFLICWLPYAGVAWYIFTHQGSEFGPVFMTLPAFFAKTSAV
YNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaacggtacagagggaccggcattctacgtgcctatgtccaatgccaccggggtagtc
cggagcccatacgaatacccacagtactacctggtggcgccctgggcatatggcttcgtg
gcggcctacatgttcttcctcatcatcaccggcttccccgtcaacttcctcacgctgtac
gtcaccatcgagcacaagaagctgcgcacacccctcaactacatcctgctgaacctggcc
attgccgacctcttcatggtgttcggcggcttcaccaccaccatgtacacctccttgcac
ggctacttcgtgttcggccgcctgggctgcaacctggagggcttctttgccaccctgggc
ggtgagatggggctaaagtcgcttgtagtactggccattgagcgctggatggtggtctgc
aaaccggtcagcaacttccgtttcggggagaaccatgccatcatgggggtggccttcacc
tgggtcatggcctgctcctgtgccgtgccgccactggtgggctggtcgcgttacatcccc
gagggcatgcagtgctcctgcggcgtcgactactacacccgcactcccggtgtcaacaac
gagtccttcgtcatctacatgttcatcgtgcacttcttcatcccactgatagtcatattc
ttctgctatggccggctggtgtgcactgtgaaggaggcggcacggcagcagcaggagtcc
gagaccacacagcgggccgagcgcgaggtcacccgcatggtcatcatcatggtcatcgcc
ttcctcatctgctggttgccctacgccggcgtggcctggtacatcttcacccaccagggc
agcgagttcgggcccgtcttcatgaccctgcccgccttcttcgccaagacgtccgccgtc
tacaacccctgcatctacatctgcatgaacaagcagttccgtcactgcatgatcaccacc
ctgtgctgcggcaagaaccccttcgaagaggaagagggcgcctccaccaccgcctccaag
actgaggcttcgtccgtgtcttccagctccgtgtctccggcgtaa

KEGG   Danio rerio (zebrafish): 30459
Entry
30459             CDS       T01004                                 
Symbol
exorh
Name
(RefSeq) extra-ocular rhodopsin
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    30459 (exorh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    30459 (exorh)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    30459 (exorh)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srw TAS2R 7TM_GPCR_Sru
Other DBs
NCBI-GeneID: 30459
NCBI-ProteinID: NP_571287
ZFIN: ZDB-GENE-991229-12
Ensembl: ENSDARG00000103574 ENSDARG00000111860
UniProt: Q9PTX9
Position
8:complement(54302693..54304381)
AA seq 354 aa
MNGTEGPNFYVPMSNRTGLVRSPFEEPQYYLAEPWQFSLLAAYMLFLILGSFPINALTLY
VTVQHKKLRTPLNYILLNLAVADLFMVLGGFTVTLYTALHGYFLLGVTGCNIEGFFATLG
GEIALWSLVVLAIERYIVVCKPMSTFRFGEKHAIIGVGFTWVMALTCAVPPLLGWSRYIP
EGMQCSCGIDYYTPKPEVHNTSFVIYMFILHFSIPLLIIFFCYSRLLCTVRAAAAQQQES
ETTQRAEREVTRMVVVMVIAFLVCWVPYASVAWYIFANQGAEFGPVFMTVPAFFAKSAAL
YNPVIYIMLNRQFRNCMLSTVCCGKNPLAEDESSSAVSSKTQSSVVSSAQVSPA
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaacgggacggagggacccaacttctacgtgccgatgtccaaccgtacgggactggtg
cgcagcccgttcgaggagccgcagtattacctggcggagccgtggcagttctccctgctg
gcggcctacatgctgttcctgatcctgggctctttcccgatcaacgcgctcacgctctac
gtcacggtgcagcacaagaagctgcgcacgccgctcaactacatcctgctgaacctggcg
gtggccgacctgttcatggtgctcggaggcttcaccgtcacgctctacaccgccctgcac
ggctacttcctgctgggggtcaccggctgcaacatcgagggcttcttcgccacactcggc
ggtgagattgcgctctggtctctggtggttctggccatcgagcgctatatagtggtctgt
aaacccatgagcacgttccgcttcggggagaaacacgccatcataggagtgggcttcacc
tgggtcatggccctcacctgcgccgtgcccccgctgctggggtggtccaggtatatccca
gaaggaatgcagtgctcgtgtggaatcgattactacactcctaagcctgaagtgcacaac
acctcgttcgtcatctacatgttcatcctgcacttctccatccctctgctcatcatcttc
ttctgctacagccgcctgctgtgcactgtccgcgctgccgccgctcagcagcaggagtcg
gagaccacgcagagggcggagcgggaagtgacgcggatggtggttgtcatggtgattgca
ttcttagtgtgctgggtgccgtatgctagtgtggcctggtacatcttcgctaaccagggc
gcagagttcggtcctgtgttcatgacggttcctgccttctttgctaagagtgcagcgctc
tataaccccgtcatctacatcatgctcaacagacagttccggaactgcatgttgtcaacg
gtgtgctgtgggaagaacccgctggccgaggatgagagcagctccgccgtgtccagcaag
acccagtcctccgtggtgtcctccgctcaggtgtctccagcctga

KEGG   Danio rerio (zebrafish): 30503
Entry
30503             CDS       T01004                                 
Symbol
opn1mw1
Name
(RefSeq) green-sensitive opsin-1
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    30503 (opn1mw1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    30503 (opn1mw1)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    30503 (opn1mw1)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srsx 7TM_GPCR_Srw 7TM_GPCR_Srv DUF2633
Other DBs
NCBI-GeneID: 30503
NCBI-ProteinID: NP_571328
ZFIN: ZDB-GENE-990604-42
Ensembl: ENSDARG00000097008
UniProt: Q9W6A5 A0A0N9NXZ8
Position
6:41181882..41183823
AA seq 349 aa
MNGTEGSNFYIPMSNRTGLVRSPYDYTQYYLAEPWKFKALAFYMFLLIIFGFPINVLTLV
VTAQHKKLRQPLNYILVNLAFAGTIMVIFGFTVSFYCSLVGYMALGPLGCVMEGFFATLG
GQVALWSLVVLAIERYIVVCKPMGSFKFSANHAMAGIAFTWFMACSCAVPPLFGWSRYLP
EGMQTSCGPDYYTLNPEYNNESYVMYMFSCHFCIPVTTIFFTYGSLVCTVKAAAAQQQES
ESTQKAEREVTRMVILMVLGFLFAWVPYASFAAWIFFNRGAAFSAQAMAVPAFFSKTSAV
FNPIIYVLLNKQFRSCMLNTLFCGKSPLGDDESSSVSTSKTEVSSVSPA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaacgggacagaagggagcaacttctacatccccatgtcaaacaggactgggcttgtg
cgaagcccttatgattacacccagtactatttggcagaaccatggaaattcaaggctctg
gctttctacatgtttctactgatcatttttggatttcccatcaatgtcctgactttggtg
gttacagcccagcacaagaaactccgacagccgctcaactacattttggtcaacttagct
tttgctggcacaattatggtcatctttggatttacggtttctttctactgctcacttgtg
ggctacatggctcttggtccattaggctgtgtaatggagggattcttcgcaacacttgga
ggtcaggttgctctttggtctttggtggttcttgccattgagaggtacatcgtggtttgc
aagccaatgggaagcttcaaattctccgcaaaccatgcgatggctggcattgctttcaca
tggttcatggcctgtagctgtgcagtccccccactttttggctggtccagatatcttccg
gaagggatgcaaacctcttgcggaccagattactacacactgaatcctgaatataacaat
gagtcttacgtcatgtacatgttcagctgccacttttgcatacccgtcaccacaattttc
tttacctatggcagtctggtctgcacagtcaaggctgctgcagctcaacagcaggaatct
gagtccactcagaaggctgagagggaagtgacacgcatggtcatcctgatggttttgggc
ttcttgtttgcttgggttccctatgccagctttgctgcctggatcttctttaacagggga
gctgctttctccgcacaagccatggctgttccagccttcttctctaagacttcagctgtt
tttaaccccatcatctatgtgctcctaaacaaacagttccgtagctgcatgcttaacacc
cttttctgtggcaagagtcctcttggtgacgatgagtcttcctcagtgtcaacaagcaaa
acagaggtgtcctctgtgtctcctgcatag

KEGG   Danio rerio (zebrafish): 30504
Entry
30504             CDS       T01004                                 
Symbol
opn1mw4
Name
(RefSeq) green-sensitive opsin-4
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    30504 (opn1mw4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    30504 (opn1mw4)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    30504 (opn1mw4)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srw 7TM_GPCR_Srsx 7TM_GPCR_Srv TAS2R Cytochrom_B_N_2 DUF2633
Other DBs
NCBI-GeneID: 30504
NCBI-ProteinID: NP_571329
ZFIN: ZDB-GENE-990604-43
Ensembl: ENSDARG00000000638
UniProt: Q9W6A6
Position
6:41200505..41202554
AA seq 349 aa
MNGTEGNNFYIPLSNRTGLARSPYEYPQYYLAEPWQFKLLAVYMFFLICLGFPINGLTLL
VTAQHKKLRQPLNFILVNLAVAGTIMVCFGFTVTFYTAINGYFVLGPTGCAIEGFMATLG
GEVALWSLVVLAVERYIVVCKPMGSFKFSASHAFAGCAFTWVMAMACAAPPLVGWPRYIP
EGMQCSCGPDYYTLNPEYNNESYVLYMFICHFILPVTIIFFTYGRLVCTVKAAAAQQQES
ESTQKAEREVTRMVILMVLGFLIAWTPYATVAAWIFFNKGAAFSAQFMAVPAFFSKTSAL
YNPVIYVLLNKQFRNCMLTTLFCGKNPLGDDESSTVSTSKTEVSSVSPA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaacggcactgaaggaaacaacttctacatccccctgtccaacaggacagggctagca
aggagtccgtacgaatatcctcagtattatcttgcggagccatggcaatttaaactgctc
gccgtctacatgttcttcctcatctgcttaggtttccccatcaatggccttacattgttg
gtaacagctcaacacaaaaagctgaggcaacctctcaacttcattctggtcaatctggct
gtggctggcaccatcatggtttgttttggattcacggtcactttctacacagccattaat
ggatactttgttctgggaccaactggctgtgcgattgagggattcatggccacactggga
ggcgaagttgccctttggtcacttgtagtgctggccgttgagagatacattgtggtttgc
aagccaatggggagtttcaaattttctgccagtcacgctttcgcaggatgcgcattcaca
tgggtaatggccatggcttgtgcagctccccctctggttggttggcccaggtatattccg
gagggaatgcagtgttcatgtggaccagactactacaccctgaacccagagtacaacaac
gaatcatatgtcctctacatgttcatctgtcattttatacttccagttactataatcttc
ttcacctatgggcgacttgtttgcacagtcaaagcggctgcagctcaacagcaggaatca
gaatccactcagaaggctgagagagaagtgaccagaatggtcatcctgatggttctgggc
ttcctgattgcttggactccttatgctactgttgctgcctggatcttctttaataaggga
gctgctttcagtgctcagttcatggctgttcctgcctttttctcaaagacctctgcattg
tataaccctgtcatctatgtgctgctaaataaacagtttcgtaattgcatgctgaccact
ctattctgtggaaagaatcctcttggcgatgatgaatcctctactgtgtccaccagcaag
acggaggtgtcttctgtatctccagcatag

KEGG   Danio rerio (zebrafish): 360151
Entry
360151            CDS       T01004                                 
Symbol
opn1mw2
Name
(RefSeq) green-sensitive opsin-2
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    360151 (opn1mw2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    360151 (opn1mw2)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    360151 (opn1mw2)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srw 7TM_GPCR_Srsx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 360151
NCBI-ProteinID: NP_878311
ZFIN: ZDB-GENE-030728-5
Ensembl: ENSDARG00000044280
UniProt: Q8AYM8 B2GP06
Position
6:41186338..41189464
AA seq 349 aa
MNGTEGNNFYIPMSNRTGLVRSPYEYTQYYLADPWQFKALAFYMFFLICFGLPINVLTLL
VTAQHKKLRQPLNYILVNLAFAGTIMAFFGFTVTFYCSINGYMALGPTGCAIEGFFATLG
GQVALWSLVVLAIERYIVVCKPMGSFKFSSNHAMAGIAFTWVMASSCAVPPLFGWSRYIP
EGMQTSCGPDYYTLNPEFNNESYVLYMFSCHFCVPVTTIFFTYGSLVCTVKAAAAQQQES
ESTQKAEREVTRMVILMVLGFLVAWVPYASFAAWIFFNRGAAFSAQAMAIPAFFSKASAL
FNPIIYVLLNKQFRSCMLNTLFCGKSPLGDDESSSVSTSKTEVSSVSPA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaacggcaccgaaggaaacaacttttacattcctatgtccaacaggactgggctagtg
aggagtccttacgaatacacacagtattacctggcagatccatggcagtttaaggcactg
gctttttacatgttttttctgatttgcttcgggctgccgatcaacgtgctcacgctgttg
gtcacagctcagcacaaaaagctgagacagcctttaaattatattttggtgaacttggct
ttcgctggaacaattatggccttttttggattcacggttacgttctattgctccattaat
ggttatatggctctaggtcctacaggttgtgccattgaaggcttctttgctacacttgga
ggtcaggttgctctttggtctcttgtggttcttgccattgagaggtacatagtggtttgc
aagccaatgggaagcttcaaattctcctcaaaccatgcgatggccggcattgccttcaca
tgggtcatggcctctagctgtgcagtccccccactttttggctggtcccgatacatccca
gagggaatgcagacatcctgcggaccagattattacaccctgaacccagaattcaacaat
gaatcatatgttttgtacatgttcagctgtcatttctgcgttcctgttacaaccatcttc
ttcacttatggaagcctcgtttgcacagtcaaagctgctgcagctcagcagcaggaatct
gagtccactcagaaggctgagagggaagtaacacgcatggtcatcctgatggttttgggc
ttcttggtggcttgggttccctatgccagctttgcggcctggatcttttttaacagggga
gctgctttctccgcacaagccatggctatcccagcttttttctcaaaagcctctgccttg
tttaaccctattatctatgtgctcctaaacaaacagttccgtagctgcatgctcaacacc
cttttctgtggcaagagtcctcttggagatgatgagtcctcctcagtttcaacaagcaaa
acagaggtgtcctctgtgtctccagcgtag

KEGG   Danio rerio (zebrafish): 360152
Entry
360152            CDS       T01004                                 
Symbol
opn1mw3
Name
(RefSeq) green-sensitive opsin-3
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    360152 (opn1mw3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    360152 (opn1mw3)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    360152 (opn1mw3)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srw 7TM_GPCR_Srv 7TM_GPCR_Srsx FXa_inhibition TAS2R DUF2633 DUF4079
Other DBs
NCBI-GeneID: 360152
NCBI-ProteinID: NP_878312
ZFIN: ZDB-GENE-030728-6
Ensembl: ENSDARG00000044279
UniProt: Q8AYM7 A0A0N9NVT6
Position
6:41191458..41193416
AA seq 349 aa
MNGTEGNNFYIPMSNRTGLVRSPYEYPQYYLAEPWQFKLLAVYMFFLMCFGFPINGLTLV
VTAQHKKLRQPLNFILVNLAVAGTIMVCFGFTVTFYTAINGYFVLGPTGCAIEGFMATLG
GQISLWSLVVLAIERYIVVCKPMGSFKFSSNHAFAGIGFTWIMALSCAAPPLVGWSRYIP
EGMQCSCGPDYYTLNPDYNNESYVLYMFCCHFIFPVTTIFFTYGRLVCTVKAAAAQQQES
ESTQKAEREVTRMVILMVLGFLVAWTPYASVAAWIFFNRGAAFSAQFMAVPAFFSKSSSI
FNPIIYVLLNKQFRNCMLTTLFCGKNPLGDDESSTVSTSKTEVSSVSPA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaacggcactgaaggaaacaacttctacatccccatgtccaacaggacagggcttgtg
aggagtccgtacgaatatcctcagtattatcttgctgagccatggcagtttaaactgctc
gccgtctacatgttcttcctcatgtgctttgggtttcccatcaatggccttacattggtg
gtaacagctcaacacaaaaagctgaggcaacctctcaacttcattctggtcaatctggct
gtggctggcaccatcatggtttgttttggattcacggtcactttctacacagccattaat
ggatactttgttctgggaccaactggctgtgcgattgagggattcatggccacactggga
gggcaaatttccctttggtcactcgtggtgctggccattgagagatacattgtggtttgc
aagccaatggggagtttcaaattttcatccaaccatgctttcgctgggattggatttaca
tggataatggccttgtcttgcgcagctcctcctctggttggctggtcaaggtatattcca
gagggaatgcagtgttcatgtggaccagactactacaccttgaaccctgactacaataat
gaatcatatgtcctctacatgttctgctgccactttatatttccagtcaccacaatcttt
ttcacctatggacgacttgtttgcacagtcaaagcggctgcagctcaacagcaggaatct
gaatccactcagaaggctgagagagaagtgaccagaatggtcatcctgatggttctgggc
ttcctggtagcttggactccttatgccagtgttgctgcttggatcttcttcaatagagga
gctgctttcagtgctcagttcatggctgttcctgcctttttctcaaagagctcttccata
ttcaaccctatcatttatgtgcttctaaacaaacagtttcgtaattgcatgctgaccact
ttattctgtggaaagaatcctctcggtgatgatgaatcctctactgtgtccaccagcaag
acggaggtgtcttctgtatctccagcatag

KEGG   Danio rerio (zebrafish): 562845
Entry
562845            CDS       T01004                                 
Symbol
rhol
Name
(RefSeq) rhodopsin, like
  KO
K04250  rhodopsin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    562845 (rhol)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dre04030]
    562845 (rhol)
G protein-coupled receptors [BR:dre04030]
 Rhodopsin family
  Vision
   Opsin
    562845 (rhol)
SSDB
Motif
Pfam: 7tm_1 Rhodopsin_N 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srw PMT_4TMC TAS2R
Other DBs
NCBI-GeneID: 562845
NCBI-ProteinID: NP_001103501
ZFIN: ZDB-GENE-070424-6
Ensembl: ENSDARG00000070666
UniProt: A4FUN8 F6P145
Position
11:complement(19095431..19097746)
AA seq 355 aa
MNGTEGPDFYVPMSNESGVVRSPYEYPQYYLASPFAFYCMAAYMLFLIVTCVPVNGLTLY
VTIENKKLRTPLNYILLNLAVADLFMVFGGFTTTFYTSMHGYFVLGRAGCNLEGLFATVG
GEIALWSLVVLAVERWVVVCKPFTKFRFSQLHATLGVAFSWSMACSCAIPPLLGWSRYIP
EGLQCSCGVDYYTPNPETENESFVIYMFVVHFSIPLTIISFCYGRLLCTVKVAAAQQQES
ETTQRAEREVTRMVILMVIAFLICWLPYASVAWYIFTHQGSQFGPVFMTVPAFFAKSSAL
YNPLIYVFMNKQFRHSMMMTVCCGKDPFQDEEEGSSSSKSKTETSSVSSSSASSA
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaacggcacagagggaccagacttttacgttcccatgtcgaatgagagtggcgtggtg
cgcagcccttatgaatacccacaatactacttggcatctccgtttgcgttctactgcatg
gccgcgtacatgctgtttctcatcgtgacctgcgttcctgtcaacggtctcactttgtac
gtaaccatcgaaaacaagaagctccggacgcctctgaactatatccttctgaatttagca
gtggctgacttgtttatggtgttcggtggatttacaacgaccttctacacctccatgcat
ggatactttgtcctgggacgggctggttgcaacttagagggtctttttgcaaccgttggc
ggtgagattgcactttggtctttggttgttctggctgttgagagatgggtagtcgtttgc
aagcctttcaccaaatttcgcttctcacaacttcatgctaccttaggagtggctttttct
tggtcgatggcctgttcgtgtgccattcctccactcctaggatggtcccggtacatcccc
gaaggcttgcagtgctcttgcggagtggactactatacgccgaatcctgagactgagaac
gagtcgtttgtcatctatatgttcgtggttcatttctcaatccctctcaccatcatttct
ttctgctatgggcgtctgctttgcactgtgaaggttgcagctgcccagcagcaagaatca
gaaactacacaaagggctgagcgcgaagtgacccgaatggtgatcctcatggtcatcgca
tttttaatatgttggctcccttatgccagcgtggcctggtacatcttcacccaccagggg
agtcaattcggccctgtttttatgacggtgccggctttttttgccaagagctcagctctc
tacaacccgctcatttacgtcttcatgaataagcagtttcgacactccatgatgatgacg
gtgtgttgtggaaaggatccgttccaggatgaggaggaaggaagctccagctctaagtct
aagactgagacctcatccgtctcctctagctcagcttcttctgcctga

DBGET integrated database retrieval system