KEGG   Danio rerio (zebrafish): 335650
Entry
335650            CDS       T01004                                 
Symbol
rcvrn2
Name
(RefSeq) recoverin 2
  KO
K13764  recoverin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    335650 (rcvrn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    335650 (rcvrn2)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   335650 (rcvrn2)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_10
Other DBs
NCBI-GeneID: 335650
NCBI-ProteinID: NP_956258
ZFIN: ZDB-GENE-030131-7590
Ensembl: ENSDARG00000019902
UniProt: F6P0K4 Q6PC38
Position
16:complement(13911692..13921415)
AA seq 193 aa
MGNAKSSAMSKEILEDLKLNTKFSENELSQWYENFQKQCPSGRITPEEFKKIYERFFPEC
DTTSYAQHVFRSFDTNDDGTLDFKEYIIALHMTSTGKTERKLEWAFSLFDVDKNGYITKS
EVAEICQAIFKLIPKEDQESLPADENTPEKRADKLWSYFNKKDNERLAEGEFIQGILENE
DAIHLIQFEHQKK
NT seq 582 nt   +upstreamnt  +downstreamnt
atggggaatgccaaaagcagtgctatgtccaaggagatcctggaggatctcaaactcaac
accaagttctcagagaacgaactgtcgcagtggtacgagaacttccagaagcagtgtccg
tctggccgtatcacacctgaagagtttaaaaagatctacgaacgattttttccggaatgt
gacaccacctcatacgcccagcacgtcttccgctcctttgacaccaatgatgacggaacg
ctggatttcaaggaatacattattgctctacatatgacatcaaccggaaagacggagcgc
aagctggagtgggccttctcacttttcgatgtcgacaaaaatggctacataaccaagtca
gaagttgcagaaatctgccaggctatctttaagctgattcccaaagaggaccaagaaagt
ctgccagccgatgagaacactcctgaaaagagagcagataaactgtggtcgtacttcaat
aaaaaggataacgagcgattggctgagggcgagtttattcaaggtattctggagaatgaa
gacgctatccaccttattcagttcgagcaccagaagaaataa

KEGG   Danio rerio (zebrafish): 570333
Entry
570333            CDS       T01004                                 
Symbol
rcvrna
Name
(RefSeq) recoverin a
  KO
K13764  recoverin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    570333 (rcvrna)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    570333 (rcvrna)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   570333 (rcvrna)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 EF-hand_10
Other DBs
NCBI-GeneID: 570333
NCBI-ProteinID: NP_001025419
ZFIN: ZDB-GENE-050913-106
Ensembl: ENSDARG00000052223
UniProt: F6NZK8 Q4V8S2
Position
3:complement(50441448..50443606)
AA seq 203 aa
MGNTKSGALSKELLEDLKLNTKYTEEELCAWYTSFLKECPSGRITKEQFEGIYASFFPDA
DPTAYARHVFRSFDTNADGTLDFKEYIVALHLTSSGKTLRKLEWAFALYDVDGNGTISKN
EVQEIVRSIFNMVPVEDQKNLPDDENTPEKRADKIWAFFGKQDNDKIGEGEFIQGVMENK
DILRLIQYDEPKKIQEKLKEKKH
NT seq 612 nt   +upstreamnt  +downstreamnt
atggggaatactaagagtggggctttgtccaaagagcttctggaggaccttaagctaaac
accaaatacacagaagaagagctctgcgcatggtacaccagctttctcaaagagtgtccc
tctggacgtattaccaaagaacagtttgagggcatctatgcaagtttcttcccagatgct
gaccctacagcatatgctaggcacgtcttccgcagctttgacaccaacgctgatggcact
ttggactttaaggagtacattgtggcactgcacctcacctcttcaggcaagaccctgcgc
aaacttgaatgggcctttgctttgtacgatgttgatggaaatgggaccatcagtaaaaat
gaggtgcaggagattgtacggtcgatattcaacatggttcctgttgaagaccagaaaaac
cttccagatgatgagaacacgccagaaaagcgagcagacaaaatctgggcttttttcgga
aagcaagataatgataagattggagagggggaattcattcagggtgtcatggagaacaaa
gacatattgaggttgatacaatatgatgagccaaagaagattcaagaaaaactcaaagaa
aagaagcattaa

KEGG   Danio rerio (zebrafish): 572207
Entry
572207            CDS       T01004                                 
Symbol
rcvrn3
Name
(RefSeq) recoverin 3
  KO
K13764  recoverin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    572207 (rcvrn3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    572207 (rcvrn3)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   572207 (rcvrn3)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 SPARC_Ca_bdg EF-hand_10
Other DBs
NCBI-GeneID: 572207
NCBI-ProteinID: NP_957119
ZFIN: ZDB-GENE-040426-1661
Ensembl: ENSDARG00000009637
UniProt: Q1LUD3 A0A8M1PFV1
Position
19:10339538..10352579
AA seq 191 aa
MGNAQSGGIPREILDDLKLTTRFSESEITQWYENFQKQCPTGRITLQQFEEIYGKFFPDS
DATTYAQHVFRSFDANDDGTLDFKEYVVALHMTSSGKSTLKLEWAFSLFDVDKNGYVTKP
EVIELSQAIFKLIPKDKQTSLPNDESTPEKRAEKLWAIFDKKDNERVAEGEFIEAIQSSD
DGLRLIQYDHK
NT seq 576 nt   +upstreamnt  +downstreamnt
atgggaaacgcacagagcggagggattcccagagaaatcctggatgacctgaagctcacc
accaggttctccgaatctgagatcacccagtggtatgagaacttccagaagcagtgtcct
acaggtcgcatcacactgcagcagttcgaggagatctacggtaaattcttccctgacagc
gatgccaccacttacgcccaacacgttttccgctcctttgatgccaatgacgatggaacg
ttagactttaaggagtacgttgtggctcttcacatgacctcctcgggcaagtccacccta
aagctggagtgggccttctcactgtttgatgtggacaagaacggttacgtcacaaaacct
gaagtgattgaactcagccaggccattttcaaactcatccccaaagacaagcagacaagt
cttcccaacgatgagagcacgccagagaaaagagcagagaaactctgggccatctttgac
aaaaaggacaacgaacgagtggcagagggggagttcattgaagccatccagtcaagcgat
gatggtctacggctcattcagtatgatcataaatga

KEGG   Danio rerio (zebrafish): 792903
Entry
792903            CDS       T01004                                 
Symbol
rcvrnb
Name
(RefSeq) recoverin b
  KO
K13764  recoverin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    792903 (rcvrnb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    792903 (rcvrnb)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   792903 (rcvrnb)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_4 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 792903
NCBI-ProteinID: NP_001304684
ZFIN: ZDB-GENE-120815-1
Ensembl: ENSDARG00000111827
UniProt: E7FBI7 A0A8M1P804
Position
12:316238..319392
AA seq 203 aa
MGNSRSSALSRDVLQELQTSTTYSQEQLFSWYQKFLNECPTGRISREQFQSIYASFFPDA
DPGAYAQHVFRSFDADSDGTLDFKEYIVALHLTSSGKTVEKLEWAFALYDVDRNGSITKN
EIHEIVKSIFNMISKEDQKNLPDDENTPEKRTDKIWDFFGKKENGKITEGEFIQGVMDNK
HILRLIQFDKPQKVQEKLKEKTQ
NT seq 612 nt   +upstreamnt  +downstreamnt
atgggaaactccaggagcagcgcgctctccagagacgtcctccaggagctgcagaccagc
accacatacagccaggagcagctcttctcctggtaccagaagttcctgaacgagtgtccg
acgggccgcatcagcagagagcagttccagagcatctacgccagcttcttcccagacgcg
gaccccggggcatacgcccagcacgtcttcaggagcttcgatgcagacagtgacggcacg
ctggacttcaaggagtacatagtggcgctgcacctcacgtcctccggcaagactgtggag
aagctggagtgggccttcgcactctacgatgtggaccggaacggcagcatcaccaaaaac
gagatccacgagatcgtcaagtcaatattcaacatgatctccaaagaagaccagaaaaac
cttccagacgacgagaacacgccagaaaaacgaactgacaaaatatgggacttttttggg
aaaaaagaaaatggtaaaataacggagggcgagttcattcagggagtgatggacaacaaa
cacatcctccgtctcattcagttcgacaaaccacagaaagtgcaagaaaaactcaaagag
aagacacagtga

DBGET integrated database retrieval system