KEGG   Danio rerio (zebrafish): 368410
Entry
368410            CDS       T01004                                 
Symbol
pde6a
Name
(RefSeq) rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
  KO
K08718  rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha [EC:3.1.4.35]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    368410 (pde6a)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    368410 (pde6a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     368410 (pde6a)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 LON_substr_bdg
Other DBs
NCBI-GeneID: 368410
NCBI-ProteinID: NP_001007161
ZFIN: ZDB-GENE-030616-42
Ensembl: ENSDARG00000000380
UniProt: A0A8M1N2Q4 Q800E7
Position
14:complement(25005401..25034169)
AA seq 858 aa
MAAVDKDVAEKFLDSNPMFAKQYYDSRFRAKVVSDLLSTTKQTAVDISSHHELSSMEECE
IIFDMVRDMQENLHMERAVFNLMRHLSFMIRADRMSLFMYRQRNGIAELATRIFNVHKDA
TLEECLVPPDSEIVYPLDTGIVGHVATAKKTVNVPDVTKDSHFSDFVDNLTEYETKNVLA
TPIMNGKDMVAVMMAVNKIGAPHFTAQDEETLKKYLNFANLVLRVFHLSYLHNCETRRGQ
VLLWSASKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKTKEFFDLWPVLMGEV
PPYSGPKTPDGREVIFYKVIDYILHGKEDIKVIPNPPADHWALVSGLPTYVAENGLICNI
MNAAQDEFFEFQKEPLDESGWMIKNVLSLPIVNKKEEIVGVATFYNRKDGKPFDEMDETL
MESLTQFLGWSVLNTDTYDKMNKLENRKDIFQDMVMYHVKCRKDEIQNILNTREMYDKEP
DECEEDELEDILNEVLPDSEESEIFEFHFCDFEFSELDLVKCGIKMYYELGVVDKFHIPR
ETLVRFVYSVSKGYRKITYHNWRHGFNVGQTMFTLLMTGDLKRYYTDLEAMAMVTAGLCH
DIDHRGTNNLYQMKSGNPLAKLHGSSILERHHLEFGKTLLRDEALNIYQNLNRRQHETVI
HLMDIAIIATDLALYFKKRTMFQKIVDQSKTYDSWDSWTKYMMLETTRKEIVMAMMMTAC
DLSAIAKPWEIQSKVALSVAAEFWEQGDLERTVLEQQPIPMMDRNKAEELPKLQCGFIDF
VCSFVYKEFSRFHVEITPMLERLLNNRKEWNALKEIHEAKVAKLDEAKKAKEEAHANSDH
KQGNSVQPAAQSKTCVIS
NT seq 2577 nt   +upstreamnt  +downstreamnt
atggctgcagtggacaaggatgtggctgagaagtttttggacagtaatccaatgtttgcc
aagcaatactatgactccaggttccgggcgaaggtcgtctctgaccttctttcgaccact
aagcaaaccgcagtggacatcagttctcaccatgaactgagctctatggaggagtgtgag
attatttttgacatggtgcgggacatgcaggagaacctgcatatggagagggccgtgttt
aacctcatgcggcatctgagctttatgatccgggcagatcgcatgagtctcttcatgtac
cgccagaggaatggaatagccgaactggccacacgaatcttcaatgtccataaagacgct
accctggaggaatgtctggtgccaccagacagcgagattgtgtacccgctggacacaggc
attgtaggacatgtggccactgctaagaagactgtcaacgtacctgatgtcacaaaggac
agccatttcagtgactttgtggacaacttgacagagtacgagaccaagaatgtgcttgcg
acccctatcatgaatggcaaggacatggtggctgtcatgatggcagtcaacaagatcggg
gctcctcatttcactgctcaggatgaagagacactgaagaaatatctcaactttgctaat
cttgtgctccgagtgtttcacctgagctacctgcacaactgtgaaaccagaagaggacaa
gtattgctctggtctgccagcaaagtgtttgaagagctgactgacattgagagacagttc
cacaaggctctttatacagtccgagcttttctcaactgtgaccgctactctgttggcctt
ctcgacatgaccaaaactaaagagttctttgacctttggcccgtactgatgggagaagta
cctccatatagcggaccaaagacccctgatggcagagaagtgatattctacaaagtgatt
gattacatattgcatggaaaggaggacatcaaagtcattcctaaccctcctgctgaccac
tgggctttagtaagtgggcttcccacctacgttgcagagaatggcctgatctgtaatatc
atgaatgctgctcaagacgaattcttcgaatttcaaaaagaacctctggatgaatctgga
tggatgataaagaatgtgctctccttgcctatcgtgaacaagaaagaggaaatcgttggc
gtggccacgttctataacaggaaagatggaaagcctttcgatgaaatggacgaaacgcta
atggagtctctcactcagttcctgggatggtcagtgctgaatacagacacatacgataag
atgaacaagctagaaaatcgtaaggacatctttcaggacatggtcatgtaccacgtcaaa
tgcaggaaggatgagattcagaatatcttgaacacacgtgagatgtatgataaagagcct
gacgaatgtgaagaggacgagctggaagatattctgaatgaagtgctgccagactctgaa
gaatctgagatctttgagtttcacttctgtgactttgaattcagtgaactggacctcgtg
aagtgtggcatcaagatgtactatgagctgggagtggtagacaagttccatattccacgg
gagactctggtgcgttttgtgtattctgtcagcaaaggctacaggaagattacctaccac
aactggaggcatggcttcaacgttggccagaccatgtttacactgcttatgacaggtgac
ctgaagcgttactatacggacctggaggcgatggcgatggtgaccgctggactctgtcat
gatattgaccaccgtggcactaacaacctctaccagatgaaatctgggaatccactagca
aagctgcatggttcctccattctcgagaggcaccatctggaatttggaaaaactctgctt
agagacgaggccttaaatatctaccagaatctgaacagaagacagcacgaaaccgtcatc
catttgatggacattgctatcatcgcaacagacttggccttgtatttcaagaaaaggacc
atgtttcagaagattgtggatcagtctaagacctacgacagctgggacagttggaccaaa
tacatgatgttggaaaccactcggaaagagattgtcatggctatgatgatgactgcctgt
gatttgtcagccatcgccaagccatgggagattcagagcaaggtggcgctgtctgttgct
gctgaattctgggaacagggtgacctggagaggacagtgctggagcagcagcccattccc
atgatggaccggaacaaggcggaggaacttcccaaactgcagtgtggttttattgatttc
gtctgttctttcgtttacaaggagttttctcgcttccatgtggagatcacaccaatgctg
gagcgtctgctgaacaacagaaaagaatggaacgcactgaaggaaatacatgaggccaaa
gtagccaagctggatgaggccaaaaaggctaaagaagaagcacatgctaactcagatcat
aaacaaggaaactctgtccaacccgcagctcagtccaagacctgtgtcatttcctag

KEGG   Danio rerio (zebrafish): 553708
Entry
553708            CDS       T01004                                 
Symbol
pde6ga
Name
(RefSeq) phosphodiesterase 6G, cGMP-specific, rod, gamma, paralog a
  KO
K13759  retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    553708 (pde6ga)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    553708 (pde6ga)
SSDB
Motif
Pfam: PDE6_gamma
Other DBs
NCBI-GeneID: 553708
NCBI-ProteinID: NP_001153298
ZFIN: ZDB-GENE-050522-144
Ensembl: ENSDARG00000056791
UniProt: Q502C6 A0A0R4IFA8
Position
3:19460991..19466020
AA seq 86 aa
MDVSKPKSTSKGATRATGPGSPHKGPPKFKQRSTRQFKSKPPKKGVIGFGEEIPGMEGLG
TDFNVICPWEAYSHLELHELAQYGII
NT seq 261 nt   +upstreamnt  +downstreamnt
atggatgtttccaagcctaaatcgaccagcaaaggtgccacacgtgccacaggacctggc
agtccccacaagggcccacctaagttcaaacagaggtcaacacgccagtttaagagcaaa
ccacccaaaaagggtgtcatcggatttggtgaagagattcctggaatggagggattggga
acagactttaacgtaatctgtccatgggaggcgtacagtcacctggagttacatgagctg
gctcaatacggcattatatga

KEGG   Danio rerio (zebrafish): 554700
Entry
554700            CDS       T01004                                 
Symbol
pde6gb
Name
(RefSeq) phosphodiesterase 6G, cGMP-specific, rod, gamma, paralog b
  KO
K13759  retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    554700 (pde6gb)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    554700 (pde6gb)
SSDB
Motif
Pfam: PDE6_gamma
Other DBs
NCBI-GeneID: 554700
NCBI-ProteinID: NP_001230011
ZFIN: ZDB-GENE-030904-1
Ensembl: ENSDARG00000101984
UniProt: B2GPQ2 Q7ZVI5
Position
12:complement(35980523..35988575)
AA seq 87 aa
MNLEPPKPEIKSATRVTGGPATPRKGPPKFKQRQTRQFKSKPPKKGIQGFGDDIPGMEGL
GTDITVICPWEAFNHLELHELAQYGII
NT seq 264 nt   +upstreamnt  +downstreamnt
atgaatcttgagccgcccaaaccagagatcaaatcggccacccgagtcaccggtggtccc
gcaacaccacgcaaagggccccctaaattcaagcagaggcaaacccgccagttcaagagc
aagcccccaaagaagggtatccaagggttcggagatgacatccccggcatggaaggttta
ggcactgacatcaccgtcatctgcccctgggaggccttcaaccatctggagcttcacgaa
ttggctcagtatggcatcatctga

KEGG   Danio rerio (zebrafish): 559332
Entry
559332            CDS       T01004                                 
Symbol
pde6b
Name
(RefSeq) rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
  KO
K13756  rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta [EC:3.1.4.35]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    559332 (pde6b)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    559332 (pde6b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     559332 (pde6b)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C
Other DBs
NCBI-GeneID: 559332
NCBI-ProteinID: XP_685002
ZFIN: ZDB-GENE-090421-2
Ensembl: ENSDARG00000011671
UniProt: E7F5I9 A0A8N7TAN6
Position
21:20356441..20376608
AA seq 854 aa
MSVKKEDVEKFLDGNPDFTKTYFDKKLKPGAVASIMRVPESKVDMDSFKEIVSVEEGAIF
YDLITDMQENVNMEKVIFKILKRISALIHADRCSLFMYRQRNGIAELATRLFNVNKDSEL
DDCVVAPDSEIVFPLDIGIVGHVAQTKKQVNVKDVTQDSHFSTFVDELTEYTTHNLLAAP
IMNGKDVVAVIMAVNKTTGPHFTDEDMDLFLKYLKVGSLNLKIFHLSYLHNCETRKGQLL
LWSANKVFEELTDIERQFHKALYTVRAYLNCDRYSVGLLDMTKEKEFFDIWPVLMGEQPP
YSGPVTPDGREIIFYKVIDYILHGKEDIKVIPNPTADHWALASGLPTYVAESGFICNIMN
AASEEMFKFQTEALDDSGWTIKNVLSLPIVNKKEEIVGVATFYNRKDGKPFDEHDEQLME
ALTQFLGWSALNTDTYDKMNKLENRKDIAQDMVLYHVKCRDDEIQDILKTREYFDREPRD
CEEEELLEILKKELPGPKKFEIYAFHFSDFDCTELQLVMCGIQMYYEVGVVKKFQVPQEV
LVRFMYSVSKGYRRITYHNWRHGFNVGQTMFTLLTTGKLKQYYTDLEVMAMITAGFLHDI
DHRGTNNLYQVKSQNPLAKLHGSSILERHHLEFGKFLLGEESLNIFQNLNRRQTEHVFHL
IDIAIIATDLALYFKKRTMFQKIVDLSETYEERKKWIDFMSLETTRKEIVMAMMMTACDL
SAITKPWEVQSKVALSVAAEFWEQGDLERTVLEQQPIPMMDRNKAAELPKLQCGFIDFVC
TFVYKEFSRFHPEIKPMFDGILNNRMHWKERQEEYEAKLKAMEEAVKARQEAAAKNAANS
NSTGGSGSKTCSIC
NT seq 2565 nt   +upstreamnt  +downstreamnt
atgagcgtcaaaaaagaagatgtggagaagttcctggatggaaatccagatttcaccaaa
acctactttgacaagaagctcaaacctggtgctgtggcctcaatcatgcgagtgcccgag
tctaaagtggacatggacagttttaaggagatcgtctcggtggaagagggagcaattttc
tacgatctcatcacagacatgcaggagaacgtcaacatggagaaggtgatttttaagatt
ttgaagagaatcagcgctctgattcatgcggaccgctgcagtctcttcatgtatcggcag
aggaacggcattgccgaattggccacacgtctcttcaacgttaataaagactcagagctg
gatgattgcgtggtagctccagactctgagatcgtcttccctctggacatcgggatagtt
ggacatgtggctcagaccaagaaacaagtcaatgtgaaggacgttacacaggacagtcac
ttcagcacattcgttgatgagcttactgaatacaccacacacaacctcctggctgcgcct
attatgaatggaaaagatgtagtagctgtgatcatggctgtcaacaagaccaccggaccc
catttcacagatgaggatatggatctttttttaaagtatctcaaagttggctctctgaac
ctgaagatttttcatctgagctaccttcacaactgtgagacgcgtaaaggacagctgctg
ttgtggtcggctaacaaggtgtttgaagagctcacagatattgaacgacagtttcacaaa
gctttgtacacagtgcgagcttacctcaactgtgacaggtactctgtgggcctgctggac
atgaccaaggaaaaggagttctttgatatttggcccgtgctgatgggggagcagccacct
tactctggccctgtaactccagacggaagagaaataattttttacaaagttatcgattat
attttgcatgggaaagaggacatcaaggtcataccaaatccaactgcagatcattgggct
ttggctagtggattacccacatatgtagcagagagtggatttatttgcaacatcatgaat
gcagcatcagaagaaatgttcaagtttcagacagaggctctggatgatagtggatggacc
atcaagaatgtgctctccttgccaattgtcaacaaaaaagaagaaattgttggcgttgca
actttctacaacaggaaggatggcaaaccatttgatgaacatgatgagcaacttatggag
gctttgacacagtttttaggctggtcggctctcaacacagacacctacgacaaaatgaat
aaactggagaacaggaaagatattgcccaggacatggtgctgtaccatgtcaaatgtcga
gatgatgagatccaagatatcctcaaaacaagagaatattttgacagggagccaagggac
tgcgaggaggaggagcttttggagattctgaaaaaagagctgcccggccccaagaagttt
gagatctacgctttccatttttcagattttgactgcactgaactccagcttgttatgtgt
ggcatccagatgtactatgaagttggagtggttaaaaagttccaggtccctcaggaggtt
ttggtgagattcatgtactctgtcagcaaaggttacaggagaatcacgtatcacaactgg
cgccatggcttcaatgttggacaaaccatgttcactttactcacgacaggcaaactgaag
cagtattacacggatttggaggtgatggccatgatcactgccggtttcttgcacgatatc
gaccacagaggcacaaataacctctaccaagtgaaatcccaaaatcctctagccaagctg
catggatcctccattctagaaaggcatcacttggaatttggcaaattcctgttaggcgaa
gagtcgttgaacattttccagaacctcaacagaagacaaacagaacatgtcttccacctc
attgatattgccattattgcaactgaccttgccttgtacttcaaaaagaggacgatgttt
cagaagattgtggatctctctgaaacctatgaagaaagaaagaaatggatagacttcatg
tcactggagacaacaaggaaagaaattgtaatggccatgatgatgacagcgtgtgatctc
tcagctatcacaaagccatgggaggtgcagagcaaggttgccctctctgtagcagctgaa
ttctgggagcagggtgaccttgagaggaccgttcttgagcaacagcctattcccatgatg
gacagaaacaaagctgcagagctgccgaagcttcagtgtggttttattgacttcgtctgt
actttcgtctataaggagttctcccgtttccatcctgaaatcaagccaatgtttgatggt
attctaaacaatcggatgcattggaaagagaggcaggaggaatatgaggcaaaactaaag
gcaatggaagaggcagtcaaagccagacaggaagcagctgccaaaaacgctgcaaattcc
aacagcaccggcggatcagggtccaagacctgctctatctgttag

DBGET integrated database retrieval system