KEGG   Danio rerio (zebrafish): 373871
Entry
373871            CDS       T01004                                 
Symbol
grk7b
Name
(RefSeq) rhodopsin kinase grk7-b
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04144  Endocytosis
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    373871 (grk7b)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    373871 (grk7b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    373871 (grk7b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     373871 (grk7b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   373871 (grk7b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal ABC1 DUF6312
Other DBs
NCBI-GeneID: 373871
NCBI-ProteinID: NP_001028262
ZFIN: ZDB-GENE-030904-3
Ensembl: ENSDARG00000055534
UniProt: Q49HM8
Position
18:complement(41740752..41754007)
AA seq 548 aa
MSDMGGLKNLVANTDYLKAQSLDEKEIKKRRCSLGLPHLGNCTDVRASVSKGFEDICEQQ
PIGRACFRQFLSVSSPEYLAAAELLDELNCWNLAEAEAKEEARLNIINKFCKADSKSFLA
FLTEDEAEKCKAVSEKDFEEVMMGQVKEATQKFLRGQPFEEYQTSLFFDRFVQWKKFEKQ
PITDKYFYEFRTLGKGGFGEVCGVQVKTTGQMYACKKLDKKRLKKKSGEKMALLEKKILE
MVNSLFIVNLAYAFDTKTHLCLVMTLMSGGDLKYHIFHVGEVGIEMERIIHYTAQITSGI
LHLHSMDIVYRDMKPENVLLDCQGQCRLSDLGLAVELPNGKTTTQKAGTKGYMAPEILKQ
EPYRTSVDWWALGCSIYEMVAGRVPFRDHKEKVAKEELLRRTLEDEVKFEHRNFDAPSKD
IISLFLKRNIEDRLGSNDDPRKHEFFKSINFPRLEAGLIPPPWEPKANVVYAKDTGDIRE
FSDVKGVKFDANDEKFFKEFSTGAVPIAWQQGMIDSGLFDELSDPNRKESAAGLEDEEQQ
KSKSCTLL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgagtgacatgggtggactgaagaacctggtggccaacacagactacctgaaagcacag
agtctagacgagaaggagatcaagaaacgaagatgtagcctaggtcttcctcatcttggg
aactgcacagatgtgcgcgcatccgtttccaagggctttgaggacatctgtgagcaacaa
cccatcgggagagcatgtttccgtcagttcctttctgtctccagtccggagtaccttgct
gctgcagagctactagatgagttgaattgctggaatttagccgaggcagaagctaaagaa
gaagccagactgaatatcatcaacaaattctgcaaagcagactctaaaagtttcctggct
tttctgacagaggatgaggcggaaaaatgcaaagctgtctctgagaaagactttgaggag
gtgatgatgggacaagtgaaagaagccacgcaaaagttccttagaggacaacctttcgag
gagtatcagaccagcctgttctttgacaggtttgtgcagtggaagaagtttgaaaagcag
cccatcactgataaatacttctatgagttcaggacattggggaaaggaggatttggagag
gtatgtggtgttcaggtcaaaaccacaggtcagatgtatgcctgcaagaaactggacaaa
aagcgtctgaagaaaaaaagcggggaaaagatggctcttctggaaaaaaaaatcttggag
atggtgaacagcctgtttattgtaaacctggcctatgcgtttgacacaaagacccacctg
tgcctggtcatgaccctgatgagcggaggggatctgaagtaccacatcttccatgtcggg
gaggttggcattgagatggagcgcatcattcactacactgcacagatcaccagtggtatc
ctgcatctacattccatggatattgtctacagggatatgaagccagagaatgtcctatta
gactgtcaaggmcagtgcaggttgtcagaccttggtctagctgtggagctaccaaatggg
aaaaccactactcaaaaggctggcaccaaagggtacatggcaccagagatcctgaagcag
gagccgtatcgtacctcagtggactggtgggctttgggctgtagcatctatgagatggtg
gccggtcgtgtcccctttagagaccacaaagaaaaggttgccaaagaagagctgttaaga
agaactctagaagatgaggtcaaatttgaacaccgaaactttgacgccccctcaaaggac
attatcagtctttttctgaagagaaacattgaggaccgccttggcagcaatgatgaccct
cggaagcatgagttcttcaaatccatcaacttccctcgactggaggctggcctcattcca
cctccatgggagcccaaagccaacgttgtgtacgctaaggacacaggtgacatccgggag
ttctctgatgtgaagggggtgaaatttgacgccaatgacgaaaagttttttaaggagttc
agcacgggggcggtgccgattgcatggcaacaggggatgattgacagcggactctttgac
gagctcagtgacccaaacaggaaggaatcggcagcgggactagaggatgaggagcagcaa
aaatccaaatcttgcactcttctctga

KEGG   Danio rerio (zebrafish): 550406
Entry
550406            CDS       T01004                                 
Symbol
grk1b
Name
(RefSeq) rhodopsin kinase GRK1b
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04144  Endocytosis
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    550406 (grk1b)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    550406 (grk1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    550406 (grk1b)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     550406 (grk1b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   550406 (grk1b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 550406
NCBI-ProteinID: NP_001017711
ZFIN: ZDB-GENE-050417-211
Ensembl: ENSDARG00000104685
UniProt: Q49HN0 Q1XHL9
Position
5:complement(54161371..54197248)
AA seq 559 aa
MDIGGLETVVANSAYVSARGSIDGAAAATMRDKKYRSKLNLPHIRQCEQMKTIVDTSFDS
MCVRQPIGKRLFQQYLESEADYKNPVDLWKDIEDYIVAQENDRAKKAQKIVNKYYESSSK
NFCDFLGDKAVSRVKEDFKNIRGDLFKESEQQLLVHLEAKALTGFKDSMYFLRYVQFKWL
ESQPVAEDWFMDFRVLGKGGFGEVHACQMKATGKMYANKKLNKKRLKKRKGYDGAIIEKR
ILAKVHSRFIVTLAYAFQTKTDLCLVMTIMNGGDLRFHMYNVDEKNPGFNETRACYYTAQ
IICGLEHLHQHRIVYRDLKPENVLLDDAGHVRLSDLGLAVELPPGKDKTQGYAGTPGFMA
PELLQKKEYDYTVDYFTLGVTLYEMVAAKGPFRCRGEQVDNNEVTRRILNDPVSYPPTFS
QELKDLCEGLMEKDPEKRLGFKNNECAELKNQSFFKELNWGRLEAGMLPPPFVPDPKMVY
AKDIDDVGAFSTVKGVVIDNKDDEFYTEFATGNVPIPWQEEMIETGVFGELNIWGQNGKL
PNDLDPNFVEAKGGGCVLL
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggatattggaggtttggagactgtggtggccaactctgcttatgtttcagcacgtggg
agcatagatggtgctgctgcagcaactatgcgtgacaaaaaataccgtagcaagctcaac
ctgccacacatcagacaatgtgaacaaatgaagactatagtggatacttcatttgacagt
atgtgcgtacgccaaccaattggtaagcgtctctttcaacaataccttgaaagtgaagca
gattacaagaatcctgtagatttgtggaaagatatcgaagattacatcgttgcccaggaa
aatgaccgagctaagaaagcacagaaaatagtcaacaaatactatgagtcttcctccaaa
aacttctgtgacttcctgggagacaaagctgtgagcagggtgaaagaggacttcaagaac
attcgaggagatctgtttaaagagagtgaacagcagctccttgtccaccttgaagctaaa
gcactcactggcttcaaggacagcatgtacttcctacgttatgtacagtttaaatggctt
gagagccagcctgttgctgaagactggtttatggattttagggtgcttgggaagggcgga
tttggtgaggtccatgcttgtcaaatgaaggcaacagggaagatgtatgcaaacaagaaa
ctgaacaagaagaggttgaagaaacgtaaaggatatgacggtgcaattatcgagaagcga
atcctggctaaagtccacagtcgtttcattgtgacactggcctatgctttccagaccaaa
acagacctctgcctggtcatgaccatcatgaatggaggagacctcagattccatatgtat
aatgtggatgagaagaatccaggctttaatgaaactagagcttgttattacacagctcag
ataatttgtgggcttgagcatttgcaccagcacaggattgtgtatagagacctcaagcca
gagaatgtactcctggatgatgcaggacatgtgcgtctgtctgatctgggtttggctgtt
gaattaccaccaggaaaagacaaaacacagggatatgcagggactccaggttttatggct
ccagaactgctacaaaagaaagagtacgactacactgtagactacttcacgcttggggtc
acactgtatgagatggttgctgccaagggaccgttcaggtgtcgtggagagcaggtggac
aacaatgaagtgactcgccgcattctgaatgaccctgtctcataccccccaactttcagt
caggagcttaaagacctctgtgaaggactcatggagaaagatccagagaagagacttggc
tttaaaaacaatgagtgtgctgagctgaagaatcagtctttcttcaaagaactcaactgg
gggagattagaagctggtatgcttcctccaccttttgtccctgatcctaaaatggtatat
gccaaggacattgatgatgtgggtgcattcagcactgtgaaaggtgtagtgattgacaac
aaagacgacgaattctacactgagtttgcaactgggaatgtaccaattccatggcaggag
gagatgattgagacaggtgtgttcggagaacttaacatttggggacaaaatggaaaactc
ccgaatgatctagatcccaactttgtagaagcaaaaggagggggatgtgtgctactgtag

KEGG   Danio rerio (zebrafish): 564152
Entry
564152            CDS       T01004                                 
Symbol
grk1a
Name
(RefSeq) rhodopsin kinase GRK1
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04144  Endocytosis
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    564152 (grk1a)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    564152 (grk1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    564152 (grk1a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     564152 (grk1a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   564152 (grk1a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 564152
NCBI-ProteinID: NP_001029353
ZFIN: ZDB-GENE-050823-1
Ensembl: ENSDARG00000058803
UniProt: Q1XHM0 B3DJQ8
Position
1:245137..256233
AA seq 563 aa
MDIGGLTTVVANSAYISARGSFDGTANPASNRDKKYHSKLKLPHITVCEDLRETLDLQFR
SICVEQPIGKRLFQEYLETANEYKGPCRLWRDVEEYDTAEDKDRTQKAAKILQRYMEPSA
KHFCPFLPENGITKVKERHQEAADDLFVEILACVFDFLKEVPFTFYLETMYFKRFLQWKW
LEMQPVAEDWFLDFRVLGKGGFGEVSACQMRATGKLYACKKLNKKRLKKRKGYEGAMVEK
RILARVHSRFIVSLAYAFQTKTELCLVMTIMNGGDLRYHIYNVDENNPGFSEPRACYYAA
QIIQGLEHLHQKKIIYRDLKPENVLLDNEGNVRISDLGLAVELADGQEKTKGYAGTPGFM
APELLKGEEYDYSVDYFTLGVTLYEFIAAKGPFRTRGEKVENKEVKKRILNDPVTYSEKF
SENAKSICEGLLAKEVDKRLGFKNGTCDEIRTHPFFSQLNWRKLDAGILPPPFVPDSKTV
YAKDLDDVGAFSTVKGVCLEDDDKCFFDEFASGNISIPWQEEMIETGIYGELNVWGPGGA
VPNDLRRESILEQPPKSSTCSVS
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggacatcggcggcctcaccacggtggtggccaactctgcctacatctccgcccgcggc
agcttcgatggcacggccaacccggcgtccaaccgagacaagaaataccactccaagctg
aagctgccgcacatcacggtctgcgaagatctccgagaaaccctggatctgcagttcagg
agcatctgtgtggagcaacccatcgggaagaggctttttcaggagtatctggagaccgcc
aatgaatacaagggcccctgccgcctgtggagggacgtagaggaatacgacacggccgag
gataaagaccgcactcagaaagctgcgaaaatcctccagcgctacatggagccctcagcc
aaacacttctgcccgtttctaccagagaatggcatcaccaaagtcaaggagcggcatcag
gaggcggcggacgacctgttcgtggagatcctggcctgcgtctttgatttcctcaaggag
gtgcccttcactttctatctagagaccatgtactttaagcgcttcttgcagtggaagtgg
ctggagatgcagccggtggccgaggactggttcctggacttccgtgttttgggaaaagga
ggattcggagaagtttctgcttgtcagatgagggccacggggaagctgtacgcctgcaag
aaactcaacaagaagaggctgaagaagaggaaaggctatgagggagcgatggtggagaag
cgtatcctggctcgtgtccacagcaggtttatcgtgtctctggcctacgccttccagacc
aaaactgagctgtgtctggtgatgaccatcatgaacggaggagacctcaggtaccacatc
tataacgtggatgagaataaccccggcttctctgagcccagagcctgttattacgccgct
cagatcatccagggcctggagcatctgcaccagaagaagatcatctacagagacctcaag
ccggagaacgtgctgctggataatgaaggtaacgtcaggatctctgacctgggcttggct
gttgaactggcagacggacaggagaaaaccaaaggttatgctggaactccagggttcatg
gcgccggagctgttgaagggtgaggagtatgattattcagtggattacttcactctgggg
gtcacgctgtacgagttcatcgccgctaaaggacccttcaggactcgaggagagaaggtg
gagaataaagaggtgaagaagcggatcctgaatgacccggtcacatattcagagaagttc
agcgagaacgctaagtccatctgcgagggtctgctggccaaagaggtggacaagagactg
ggcttcaagaacggcacatgtgatgagatccgcacacatcccttcttcagccaactcaac
tggaggaaactagacgcaggtattcttcctcctccgttcgtcccggactctaagacggtc
tatgcgaaggatctagatgacgtgggcgcgttctccacggtgaagggcgtctgtctggag
gatgatgataagtgtttcttcgatgagtttgcgtcagggaatatctccattccatggcag
gaggagatgatcgagacggggatctacggcgagctgaacgtctgggggcccggaggagct
gtgcccaatgacctgcgccgggagtccatcctagagcagccgcccaaatcctccacctgc
agcgtctcctaa

KEGG   Danio rerio (zebrafish): 566120
Entry
566120            CDS       T01004                                 
Symbol
grk7a
Name
(RefSeq) rhodopsin kinase grk7a
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04144  Endocytosis
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    566120 (grk7a)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    566120 (grk7a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    566120 (grk7a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     566120 (grk7a)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   566120 (grk7a)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like ABC1
Other DBs
NCBI-GeneID: 566120
NCBI-ProteinID: NP_001027011
ZFIN: ZDB-GENE-050824-1
Ensembl: ENSDARG00000020602
UniProt: Q49HM9
Position
2:16536496..16544161
AA seq 549 aa
MCDMGGLDNLVANTAYLKAQGGDDKEMKKRRRSLSLPKPEQCASLRTSLDKDFESLCEKQ
PIGKKLFRQYLSQGGPECTTAAEFLDDLNEWELSESAARDKARTNIINKFCKEGSKSSLT
FLTGDVATKCKAVSDKDFEEVMGQVKTATKEFLKGKPFTEYQASPFFDKFLQWKEYEKQP
ISEKYFYEFRTLGKGGFGEVCAVQVKNTGQMYACKKLCKKRLKKKHGEKMALLEKKILER
VNSLFIVSLAYAYDTKTHLCLVMSLMNGGDLKYHIYNIGEKGIEMDRIIYYTAQIATGIL
HLHDMDIVYRDMKPENVLLDSQGQCRLSDLGLAVEIAVGKTISQKAGTGAYMAPEILNET
PYRTSVDWWALGCSIYEMVAGYTPFKGPDAKKEKVEKEEVQRRILNEEPKFEHKNFDAAT
IDIIKQFLKKKIDERLGCKNDDPRKHEWFKSINFARLEAGLIDPPWVPKPNVVYAKDTGD
IAEFSEIKGIEFDAKDDKFFKEFSTGAVSIAWQQEMIDTGLFDELSDPNRKESSGGSDDD
KKSGTCTLL
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgtgtgacatggggggactcgataacttggtggccaacacggcctacctgaaagcccaa
gggggtgacgacaaggagatgaagaaacgtcgccggagtctgtctctgcccaagccggag
caatgtgcttcgctcaggacgagtctggacaaggactttgaatccctctgcgaaaagcaa
ccgattggaaagaagctgttccgccagtacctcagtcaaggggggccggagtgcaccacc
gctgcagaatttctggatgatctgaacgagtgggaactgtctgagagtgctgccagagat
aaggctcgtacaaacatcatcaacaagttctgcaaagagggttccaagagctccctcacc
tttctgaccggagatgtagcaaccaagtgcaaggcggtttctgataaagatttcgaggag
gtgatgggacaggtgaagaccgccaccaaagagttcctcaaaggcaagccgtttacagaa
taccaggcatctccgttcttcgacaaatttctacagtggaaagagtacgagaaacaacct
atcagtgagaagtacttctacgaattcaggactcttggaaagggtggatttggagaggtg
tgcgcagtgcaagtgaagaacaccggccagatgtacgcctgtaagaagctctgcaaaaag
cgcctcaagaagaaacatggtgagaaaatggccctgctcgagaagaagatcttggagagg
gtcaacagcctgttcattgtcagcttggcttacgcttatgacaccaagacccacctctgc
ctggtcatgagcttgatgaatggaggtgatcttaagtatcacatctataacattggggag
aagggaatcgaaatggatcggatcatctattatacagcccagattgcaaccgggatcctt
catctgcacgacatggacatcgtgtatcgtgacatgaagccagagaacgtgcttttggat
agccagggccagtgccgtctttcagatcttggtctcgctgtggagattgctgttgggaag
accatcagccagaaggctggaacaggtgcgtatatggcacctgaaatcctcaatgagact
ccatacagaacatcagtggactggtgggccctgggctgtagtatctatgaaatggtggct
ggatataccccatttaaaggccctgatgctaagaaggagaaggtggagaaggaagaggta
cagaggcgcatccttaatgaggagcccaagtttgagcacaagaacttcgacgctgccacc
atagacatcatcaagcagttcctcaagaagaagatcgatgaacgtcttggctgcaagaat
gatgatcctaggaagcacgagtggttcaagtccatcaactttgctcgcttggaggctgga
ctaatcgatccaccctgggtgcccaaacccaatgtggtctatgcaaaggatacaggtgac
attgcagagttctctgaaattaagggtattgagtttgacgccaaggatgacaaattcttc
aaggaatttagcacaggtgcggtgtccattgcctggcaacaggagatgattgacactgga
ctttttgatgagctcagtgatccgaaccggaaagagtcttccggtggctccgatgatgat
aagaaatcaggcacttgcactcttctgtga

DBGET integrated database retrieval system