KEGG   Danio rerio (zebrafish): 767636
Entry
767636            CDS       T01004                                 
Symbol
rgs9a
Name
(RefSeq) regulator of G-protein signaling 9a
  KO
K13765  regulator of G-protein signaling 9
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    767636 (rgs9a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:dre03037]
    767636 (rgs9a)
Cilium and associated proteins [BR:dre03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   767636 (rgs9a)
SSDB
Motif
Pfam: RGS_DHEX RGS DEP G-gamma
Other DBs
NCBI-GeneID: 767636
NCBI-ProteinID: NP_001314729
ZFIN: ZDB-GENE-060929-92
Ensembl: ENSDARG00000037925
UniProt: A0A8M1P8B2 A0A2R8QUQ1
Position
3:36366546..36401994
AA seq 480 aa
MTIRSDRDHGQHYRPRMTCLKKLEAMVVQMQDPSTGVKGSDQKLNVTTIPHVMTDQDIIA
WIAKHMSMENNEAQAFGTMLVAYGYIYPLQDHKKLVLKSDGSLYRFQTPYFWPVQKWAAE
DIDYAIYLAKRNIRKKGALDAHEQEEYDKLHKWMNHKWDFIVMQAKEQYHAGKARPKADR
VVFDCQERAYWIVHRPPPQTHSAMDYGLDRHIDPNTEEKKTFDYYRRINIYTQQAIMRSR
VKSSVSLGAMLKYITNFNNHDPFLVPCLPSNPWLTDNDAYWELNTDDIEVPTKMRVERWS
FSFYELLNDPRGRADFKVFLKKEFSGENLAFWEAAEELKFGSAATMSEKAEQVFKTFLAP
GAPRWINIDGRTMGLTVKGLEHPHRYVLEAAQTHIFMLMKKDTFYRYLKSPVYKDIQKKA
ISPAPHNFTEAQLEQNMRNRRPSISPIITYQKEQEEKAKAAAAAGPVDIKKLMASKLDRK
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgacaataagatcggaccgagaccatggacaacattataggccacggatgacctgcctt
aaaaagctggaggccatggtggttcaaatgcaagacccatcaactggtgtgaagggatca
gatcagaagctaaacgttactaccattcctcatgtcatgacggaccaggacattattgca
tggatcgctaaacatatgagcatggagaataatgaggctcaagcatttggcacaatgtta
gtggcatatggatacatctatcctctgcaggaccacaaaaagctcgtccttaaatcagac
ggcagtttgtatcgctttcagaccccctatttctggcctgtgcagaagtgggccgctgag
gacattgactatgcaatctatctggcaaaaagaaatattagaaaaaaaggagcgcttgat
gctcatgaacaggaggaatacgacaaactccacaaatggatgaaccacaaatgggatttt
attgtgatgcaagctaaagagcagtaccatgctgggaaggcacgtccgaaagcagacaga
gttgtgtttgactgtcaggaaagagcatactggatagtccacaggcctccaccacaaact
cacagcgcaatggattatggcctggatcgtcatattgatcctaatacagaggagaaaaaa
acctttgattactacagaagaatcaacatctacacacaacaggccatcatgaggtcaagg
gtcaagtcttcagtgtctctcggagccatgctaaagtatataacaaacttcaataaccat
gacccgttcctggttccctgccttcctagcaatccctggctgacagataatgacgcgtac
tgggagctgaacacagacgatattgaagtccccacaaagatgagagtggagcgctggtct
ttcagcttctacgagctgctcaatgacccacgaggccgtgcagacttcaaggtcttcctg
aaaaaagaattcagcggtgagaatttagctttctgggaagctgctgaggagttaaaattt
ggctcagcagctacaatgtcagaaaaagctgaacaagttttcaaaacgtttttggcccca
ggagctccacgctggatcaacattgacggcaggacaatgggtcttacagtaaagggactg
gagcatcctcaccgctatgtgctggaggcggcacagactcacatcttcatgctcatgaag
aaggataccttttatcgctacttgaagtcaccagtttataaggacatacagaaaaaggcc
atttcacctgcaccacacaacttcactgaagcgcagctggagcagaacatgaggaaccga
cggccgagcatcagccccatcatcacctaccagaaggagcaggaggagaaagcaaaggcc
gcggccgcagcaggacccgtcgacatcaaaaaactgatggccagcaaactagaccgcaaa
tag

KEGG   Danio rerio (zebrafish): 793087
Entry
793087            CDS       T01004                                 
Symbol
rgs9b
Name
(RefSeq) regulator of G-protein signaling 9b
  KO
K13765  regulator of G-protein signaling 9
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    793087 (rgs9b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:dre03037]
    793087 (rgs9b)
Cilium and associated proteins [BR:dre03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   793087 (rgs9b)
SSDB
Motif
Pfam: RGS_DHEX RGS DEP G-gamma DUF4198
Other DBs
NCBI-GeneID: 793087
NCBI-ProteinID: NP_957124
ZFIN: ZDB-GENE-040426-1708
Ensembl: ENSDARG00000045156
UniProt: A0A8M1PFV7 Q6ZM84
Position
12:18681351..18717659
AA seq 661 aa
MTIRNVRDHGQRYRPRMACLKKVESVVLEMQDPKTGVKCQTQRLVITTIPHAITGEDIVA
WIAYRFKVDALEARAMGTMMVAFGYIYPLQDHKRLILKPDTSLYRFQTPYFWPAQQWPVE
DTDYAIYLAKRNIRKKGMLELYEQEEYNNLYKWMNHKWDFIVMQAKEQAGKERKKPDRVV
FDCQERAYWVVHRPPPGTVSAMDYGHERMIDPNMEEVKKKTSDYYRRIIMFTQQCIMRPR
VKSSVSIGAIVKYSTTYKEHDPFLHPCLPSSPWLTDDITYWTLNMPNVETPTKMRVERWT
FSFGELLTDQRGRADFRLFLKKEFSGENLAFWEACEDLKWGAAETMKEKAQQIYKTFLAR
GAPRWINIDGKTMEITVKGLGHPHRYVLDAAQTHIYMLMKKDSYGRYLKSPVFKETQKKA
IAPEAHRFSEAQLEQNAKRRRPSLSPIILRQQEEEQKAKLAASGPVDITQLCRFTAPVPH
LAVYTGFCEAQSTTSPGLMTLPNSAACPSPISVAIDSTPASERRFDGNGGPSSSHFPSIA
EAPVSEEENQPPAPKSRMALSLSRLLRRGCNAPSVFASLSPKCGVASGGGKVQPLGVEPL
TQPQPRRIANFFQIKVDIPPECRIYPIDSEDEEDDSPNTARGGVKEIICPWETVTKQDGT
G
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaccataaggaatgtccgggaccacgggcagcgttacagaccgcggatggcatgcctg
aagaaggtagaatctgtggtgttggagatgcaggaccccaaaactggtgtaaaatgtcag
acacaaaggcttgttatcaccaccataccacatgctataacaggggaagatattgtggca
tggattgcttatcgattcaaagtagatgctctggaggcccgagctatgggcaccatgatg
gtggcatttggatacatctatccactacaagaccataagagacttatccttaaaccagac
acatccttgtatcgctttcagacaccatatttttggcctgcacagcaatggccggtggaa
gatacagactatgcaatatatttggcgaaaagaaatatacgcaagaaagggatgctggag
ctgtatgaacaggaagagtacaacaatctttacaagtggatgaatcacaagtgggatttt
attgtaatgcaggccaaagagcaggcaggtaaggagaggaagaaaccagaccgggtggtt
tttgactgtcaggaacgggcctactgggttgtacatcggccaccaccaggaacagttagt
gccatggactatggacatgaaaggatgatcgaccccaatatggaggaggtaaagaaaaaa
acatctgactactacagaagaattatcatgttcactcagcagtgcatcatgagaccaagg
gtaaagtcatctgtgtcaattggagcaattgttaagtactcaacaacatacaaagagcac
gacccctttctccacccgtgtcttccgagtagcccctggttaactgatgatattacatat
tggactcttaacatgccaaatgttgagacccctactaaaatgagggtggagcgctggact
ttcagctttggagaactgctgactgaccaacgaggaagggctgatttccgactcttcctt
aaaaaggagttcagtggtgagaatcttgccttctgggaggcttgtgaagatctgaaatgg
ggtgcagcagagacaatgaaagaaaaggctcagcaaatatacaagacctttttggctcgt
ggagctcctcgttggattaacattgatgggaaaacaatggaaataacagtgaagggtttg
ggacaccctcatcgttatgtactggatgctgcccagactcacatttacatgctcatgaaa
aaggactcatacgggcgatatctcaagtccccggtgtttaaggaaactcagaagaaagcc
attgctcctgaagcacacagattcagtgaggcgcagttggagcagaacgctaaaagaagg
cgacccagtctgagtcccatcatccttaggcagcaggaggaagaacagaaggccaaactt
gcagcaagtggcccagtggacatcacacagctctgccggttcacagcacctgtgcctcat
ctggccgtatatacaggcttttgtgaagcacagtccactacctccccaggcctcatgacg
ctgcccaacagtgctgcctgtccttcgcccatcagtgtggccatcgacagcactccagcc
tcagagcggaggtttgacggtaacggagggccttcgtcctcacatttcccttccattgca
gaggcacctgtgtctgaagaagagaaccagccgcctgcacccaagtctcgcatggctctg
tctctgagcagactcctccgcagaggatgcaatgctccgtctgtctttgccagtctgtcc
ccgaaatgtggtgtagcttcagggggaggcaaagtacagcccctcggagtggagccactt
acacaaccacagcccaggagaattgcaaacttttttcaaatcaaagttgacatcccacct
gaatgccgcatctaccccatcgattccgaagacgaggaggacgacagtcccaatacagca
agaggaggtgtgaaagaaatcatttgcccatgggaaactgtcacgaaacaagatggaaca
ggataa

DBGET integrated database retrieval system