KEGG   Danio rerio (zebrafish): 792319
Entry
792319            CDS       T01004                                 
Symbol
saga
Name
(RefSeq) S-arrestin a
  KO
K19627  S-arrestin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    792319 (saga)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C DUF5796
Other DBs
NCBI-GeneID: 792319
NCBI-ProteinID: NP_956853
ZFIN: ZDB-GENE-040426-1538
Ensembl: ENSDARG00000012610
UniProt: Q6NUV2 F6NUA2
Position
2:complement(5480125..5505020)
AA seq 392 aa
MSPKNVVFKKISKDKSVGVYMGKRDFVDRVDSVDPVDGVILIDPEQLRGKKAYVTLSCVF
RYGRDDDAEVLGISFRKEIYISTRQVYPALQDKEQCILTKVQEKLLRKLGDNAYPFFFEF
PDNLPCSVGLQPAPKDVGKHCAVEFEVKAFCAESQDAKVRKRSSVGLMIRKVQYAPEKLG
PAPSVETTRDFLMSDKPLHLEASLEKQTYYHGEPINVRVKINNQSNKNVRNIILSVEQNA
NVVLYCNDNYMKVVATEDSGHSVDSGAKLEKVYTLLPLLANNRERRGIALDGKLKHEDTN
LASSSIIKEGVQKEVLGIMVSYRVVVKLIVGGMMGSSEVGVELPFQLMHPKPDAVKESEA
EEEMVFEEFKRTYLKGMPEDEDEGNANIEENV
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgagtccaaaaaatgtcgttttcaagaaaatttccaaagacaagtcggtgggtgtgtat
atggggaagagagactttgttgaccgagtggactcagtagatccagtggacggtgtcatt
cttattgaccctgaacagctgaggggcaaaaaagcatatgtcacattgtcatgcgtgttc
cggtatggccgtgatgacgacgcagaggtgttgggtatctcgtttaggaaagagatctac
atttccacccggcaggtctaccccgcactgcaggacaaagagcagtgcattctcaccaaa
gtgcaggagaaactactgcgcaaactgggggacaatgcctacccctttttctttgaattc
cctgataacttgccctgctcagttggactgcagccagccccaaaagatgtcggaaagcac
tgtgctgttgagtttgaggtgaaagccttctgtgctgagagccaggatgccaaagttcgc
aaacggagctcagtcggtctgatgatccgtaaggtccagtatgccccagagaagctcgga
cccgctcccagtgtggagaccacccgtgacttcctcatgtctgacaaaccgctgcatttg
gaagctagcttggagaagcagacgtactatcacggagaacccatcaacgtaagggtcaaa
atcaataaccaatccaacaaaaatgtgaggaacatcatcctttccgtggaacaaaacgcc
aacgtggtgctgtactgcaatgacaattatatgaaggtggtggccacagaggattctggg
cactctgttgattctggtgccaaactggagaaagtctacactttgctacccctgctggcc
aataacagagaacgccgaggaattgcgctggatggaaaattaaagcatgaagatactaat
ctagcctcttccagcatcattaaagaaggcgttcagaaggaagttctgggaatcatggtg
tcttacagagttgttgtgaagcttattgttggaggcatgatgggatccagtgaggtcgga
gtggaacttccttttcaacttatgcacccaaagcctgacgcagtgaaggaaagtgaagcg
gaagaagaaatggtatttgaggagttcaagcgcacctacctgaagggcatgcctgaggac
gaggatgaaggaaatgcgaacattgaggagaacgtgtag

DBGET integrated database retrieval system