KEGG   Dipodomys spectabilis (banner-tailed kangaroo rat): 122108047
Entry
122108047         CDS       T07891                                 
Name
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
dsp  Dipodomys spectabilis (banner-tailed kangaroo rat)
Pathway
dsp01521  EGFR tyrosine kinase inhibitor resistance
dsp01522  Endocrine resistance
dsp01524  Platinum drug resistance
dsp04012  ErbB signaling pathway
dsp04014  Ras signaling pathway
dsp04015  Rap1 signaling pathway
dsp04024  cAMP signaling pathway
dsp04062  Chemokine signaling pathway
dsp04066  HIF-1 signaling pathway
dsp04068  FoxO signaling pathway
dsp04070  Phosphatidylinositol signaling system
dsp04071  Sphingolipid signaling pathway
dsp04072  Phospholipase D signaling pathway
dsp04081  Hormone signaling
dsp04140  Autophagy - animal
dsp04145  Phagocytosis
dsp04150  mTOR signaling pathway
dsp04151  PI3K-Akt signaling pathway
dsp04152  AMPK signaling pathway
dsp04210  Apoptosis
dsp04211  Longevity regulating pathway
dsp04213  Longevity regulating pathway - multiple species
dsp04218  Cellular senescence
dsp04360  Axon guidance
dsp04370  VEGF signaling pathway
dsp04380  Osteoclast differentiation
dsp04510  Focal adhesion
dsp04517  IgSF CAM signaling
dsp04518  Integrin signaling
dsp04550  Signaling pathways regulating pluripotency of stem cells
dsp04611  Platelet activation
dsp04613  Neutrophil extracellular trap formation
dsp04620  Toll-like receptor signaling pathway
dsp04625  C-type lectin receptor signaling pathway
dsp04630  JAK-STAT signaling pathway
dsp04650  Natural killer cell mediated cytotoxicity
dsp04660  T cell receptor signaling pathway
dsp04662  B cell receptor signaling pathway
dsp04664  Fc epsilon RI signaling pathway
dsp04666  Fc gamma R-mediated phagosome formation
dsp04668  TNF signaling pathway
dsp04670  Leukocyte transendothelial migration
dsp04722  Neurotrophin signaling pathway
dsp04725  Cholinergic synapse
dsp04750  Inflammatory mediator regulation of TRP channels
dsp04810  Regulation of actin cytoskeleton
dsp04910  Insulin signaling pathway
dsp04914  Progesterone-mediated oocyte maturation
dsp04915  Estrogen signaling pathway
dsp04917  Prolactin signaling pathway
dsp04919  Thyroid hormone signaling pathway
dsp04923  Regulation of lipolysis in adipocytes
dsp04926  Relaxin signaling pathway
dsp04929  GnRH secretion
dsp04930  Type II diabetes mellitus
dsp04931  Insulin resistance
dsp04932  Non-alcoholic fatty liver disease
dsp04933  AGE-RAGE signaling pathway in diabetic complications
dsp04935  Growth hormone synthesis, secretion and action
dsp04960  Aldosterone-regulated sodium reabsorption
dsp04973  Carbohydrate digestion and absorption
dsp05010  Alzheimer disease
dsp05017  Spinocerebellar ataxia
dsp05020  Prion disease
dsp05100  Bacterial invasion of epithelial cells
dsp05135  Yersinia infection
dsp05142  Chagas disease
dsp05146  Amoebiasis
dsp05160  Hepatitis C
dsp05161  Hepatitis B
dsp05162  Measles
dsp05163  Human cytomegalovirus infection
dsp05164  Influenza A
dsp05165  Human papillomavirus infection
dsp05166  Human T-cell leukemia virus 1 infection
dsp05167  Kaposi sarcoma-associated herpesvirus infection
dsp05168  Herpes simplex virus 1 infection
dsp05169  Epstein-Barr virus infection
dsp05170  Human immunodeficiency virus 1 infection
dsp05171  Coronavirus disease
dsp05200  Pathways in cancer
dsp05203  Viral carcinogenesis
dsp05205  Proteoglycans in cancer
dsp05206  MicroRNAs in cancer
dsp05207  Chemical carcinogenesis - receptor activation
dsp05208  Chemical carcinogenesis - reactive oxygen species
dsp05210  Colorectal cancer
dsp05211  Renal cell carcinoma
dsp05212  Pancreatic cancer
dsp05213  Endometrial cancer
dsp05214  Glioma
dsp05215  Prostate cancer
dsp05218  Melanoma
dsp05220  Chronic myeloid leukemia
dsp05221  Acute myeloid leukemia
dsp05222  Small cell lung cancer
dsp05223  Non-small cell lung cancer
dsp05224  Breast cancer
dsp05225  Hepatocellular carcinoma
dsp05226  Gastric cancer
dsp05230  Central carbon metabolism in cancer
dsp05231  Choline metabolism in cancer
dsp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
dsp05415  Diabetic cardiomyopathy
dsp05417  Lipid and atherosclerosis
dsp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:dsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    122108047
   04014 Ras signaling pathway
    122108047
   04015 Rap1 signaling pathway
    122108047
   04370 VEGF signaling pathway
    122108047
   04630 JAK-STAT signaling pathway
    122108047
   04668 TNF signaling pathway
    122108047
   04066 HIF-1 signaling pathway
    122108047
   04068 FoxO signaling pathway
    122108047
   04070 Phosphatidylinositol signaling system
    122108047
   04072 Phospholipase D signaling pathway
    122108047
   04071 Sphingolipid signaling pathway
    122108047
   04024 cAMP signaling pathway
    122108047
   04151 PI3K-Akt signaling pathway
    122108047
   04152 AMPK signaling pathway
    122108047
   04150 mTOR signaling pathway
    122108047
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    122108047
   04517 IgSF CAM signaling
    122108047
   04518 Integrin signaling
    122108047
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagocytosis
    122108047
   04140 Autophagy - animal
    122108047
  09143 Cell growth and death
   04210 Apoptosis
    122108047
   04218 Cellular senescence
    122108047
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    122108047
   04550 Signaling pathways regulating pluripotency of stem cells
    122108047
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    122108047
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    122108047
   04613 Neutrophil extracellular trap formation
    122108047
   04620 Toll-like receptor signaling pathway
    122108047
   04625 C-type lectin receptor signaling pathway
    122108047
   04650 Natural killer cell mediated cytotoxicity
    122108047
   04660 T cell receptor signaling pathway
    122108047
   04662 B cell receptor signaling pathway
    122108047
   04664 Fc epsilon RI signaling pathway
    122108047
   04666 Fc gamma R-mediated phagosome formation
    122108047
   04670 Leukocyte transendothelial migration
    122108047
   04062 Chemokine signaling pathway
    122108047
  09152 Endocrine system
   04910 Insulin signaling pathway
    122108047
   04923 Regulation of lipolysis in adipocytes
    122108047
   04929 GnRH secretion
    122108047
   04915 Estrogen signaling pathway
    122108047
   04914 Progesterone-mediated oocyte maturation
    122108047
   04917 Prolactin signaling pathway
    122108047
   04926 Relaxin signaling pathway
    122108047
   04935 Growth hormone synthesis, secretion and action
    122108047
   04919 Thyroid hormone signaling pathway
    122108047
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    122108047
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    122108047
  09156 Nervous system
   04725 Cholinergic synapse
    122108047
   04722 Neurotrophin signaling pathway
    122108047
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    122108047
  09158 Development and regeneration
   04360 Axon guidance
    122108047
   04380 Osteoclast differentiation
    122108047
  09149 Aging
   04211 Longevity regulating pathway
    122108047
   04213 Longevity regulating pathway - multiple species
    122108047
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    122108047
   05206 MicroRNAs in cancer
    122108047
   05205 Proteoglycans in cancer
    122108047
   05207 Chemical carcinogenesis - receptor activation
    122108047
   05208 Chemical carcinogenesis - reactive oxygen species
    122108047
   05203 Viral carcinogenesis
    122108047
   05230 Central carbon metabolism in cancer
    122108047
   05231 Choline metabolism in cancer
    122108047
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    122108047
  09162 Cancer: specific types
   05210 Colorectal cancer
    122108047
   05212 Pancreatic cancer
    122108047
   05225 Hepatocellular carcinoma
    122108047
   05226 Gastric cancer
    122108047
   05214 Glioma
    122108047
   05221 Acute myeloid leukemia
    122108047
   05220 Chronic myeloid leukemia
    122108047
   05218 Melanoma
    122108047
   05211 Renal cell carcinoma
    122108047
   05215 Prostate cancer
    122108047
   05213 Endometrial cancer
    122108047
   05224 Breast cancer
    122108047
   05222 Small cell lung cancer
    122108047
   05223 Non-small cell lung cancer
    122108047
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    122108047
   05170 Human immunodeficiency virus 1 infection
    122108047
   05161 Hepatitis B
    122108047
   05160 Hepatitis C
    122108047
   05171 Coronavirus disease
    122108047
   05164 Influenza A
    122108047
   05162 Measles
    122108047
   05168 Herpes simplex virus 1 infection
    122108047
   05163 Human cytomegalovirus infection
    122108047
   05167 Kaposi sarcoma-associated herpesvirus infection
    122108047
   05169 Epstein-Barr virus infection
    122108047
   05165 Human papillomavirus infection
    122108047
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    122108047
   05100 Bacterial invasion of epithelial cells
    122108047
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    122108047
   05142 Chagas disease
    122108047
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    122108047
   05017 Spinocerebellar ataxia
    122108047
   05020 Prion disease
    122108047
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    122108047
   05418 Fluid shear stress and atherosclerosis
    122108047
   05415 Diabetic cardiomyopathy
    122108047
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    122108047
   04932 Non-alcoholic fatty liver disease
    122108047
   04931 Insulin resistance
    122108047
   04933 AGE-RAGE signaling pathway in diabetic complications
    122108047
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    122108047
   01524 Platinum drug resistance
    122108047
   01522 Endocrine resistance
    122108047
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dsp04131]
    122108047
Membrane trafficking [BR:dsp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    122108047
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 SH2_1 DicA_C Legum_prodom ODF2_C PI_PP_I Exonuc_VII_L
Other DBs
NCBI-GeneID: 122108047
NCBI-ProteinID: XP_042535952
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDCSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQYSKEY
IERFRREGNEKEIERIMMNFDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNTWLGIKNEDVDESYYINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGSFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagttacaaatgggatgaaagactgttccgtttctctt
caggatgcagaatggtactggggggatatttccagggaggaggtaaatgacaaattacgg
gacatgccagatggtaccttcttggttcgagatgcttcaacaaaaatgcagggagattat
actttgactttgaggaaaggaggcaataataagttaataaagatctatcatcgggatggt
aaatatggcttttctgatcctttgacatttaattctgtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccagatatcaacaggatcagttggtaaaagaagataatattgatgcagtaggcaaaaaa
cttcaagagtaccactctcagtatcaggaaaagagtaaagaatatgacaggctatatgaa
gaatataccagaacatcccaggaaatacaaatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaggagcaatgtcacacacaagaacaatatagcaaagaatat
attgagcgatttcgcagagaaggaaatgaaaaggaaattgaacgaattatgatgaatttt
gacaaattgaaatcacgtcttggtgagattcatgatagcaaaatgcgtctggaacaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gacctgatccagctgcgcaagatacgagatcagcatcttgtgtggcttaatcacaaagga
gtgagacagaagcgcctcaatacctggctgggaataaaaaatgaggatgttgatgagtcc
tattatatcaatgaggaagatgaaaacctgccacattatgatgagaaaacttggtttgtt
gaggatatcaatcgagtacaagccgaggacttgctctatgggaagcctgatggttcattc
ttaattcgtgagagcagcaagaaaggatgctatgcttgttctgtagttgctgatggggag
gtgaagcactgtgtgatctacagtacggcacgaggatatggcttcgcagagccctacaac
ctgtacagctccctgaaggagctggtgctccactaccagcagacatccctggttcagcac
aacgactccctcaatgtcaggcttgcctaccctgtccatgcacagatgccttcgctctgc
agataa

DBGET integrated database retrieval system