KEGG   Dactylosporangium vinaceum: Dvina_30565
Entry
Dvina_30565       CDS       T07478                                 

Name
(GenBank) glycoside hydrolase family 15
  KO
K22308  isomaltose glucohydrolase [EC:3.2.1.205]
Organism
dvc  Dactylosporangium vinaceum
Brite
KEGG Orthology (KO) [BR:dvc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dvina_30565
Enzymes [BR:dvc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.205  isomaltose glucohydrolase
     Dvina_30565
SSDB
Motif
Pfam: Glyco_hydro_15 TPR_4
Other DBs
NCBI-ProteinID: UAB92670
Position
complement(6773870..6774946)
AA seq 358 aa
MHDLVEHSLKVISREQAPSGAYPACSNFPVYGYAWLRDGAFVADGVLAHGVTDGPRAFHD
WTARVIAERAERIDEVVATLAAGAEVAPDSFLPTRYTLDGGDGTESWWDFQLDGYGTWLF
VLERFLHSVPADGPSLRPAVRSTVRYLCATWRLPCYDWWEEHSDQVHVSTLTAVEAGLRA
ALRTGLLDDDLAAQATSAASSIALVVAREGTVDGRLRKWLGSDAVDGSLLAAFAPFGVVD
AGTGARTVAAVERDLLDGGGVHRFRADVFYGGGRWPVLAALLGHAYLALDRPADARRQLA
WIAGTAAPNGDLPEQVSDRLLAPEHRQEWLDRWGPVATPLLWSHGAFLSLAARLGVTA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcacgacctggtcgagcacagcctcaaggtgatcagccgtgagcaggccccttcgggg
gcctacccggcctgctccaacttccccgtgtacggctacgcgtggcttcgcgacggcgcc
ttcgtggccgacggggtgctcgcccacggcgtcaccgacgggccgcgggcgttccacgac
tggaccgcccgcgtcatcgccgagcgcgccgagcgcatcgacgaggtcgtcgccaccctg
gccgcgggcgccgaggtggcacccgacagtttcctgccgacgcgatacacccttgacggc
ggcgacggtaccgagagctggtgggacttccagctcgacggctacggcacctggctgttc
gtgctggagcggttcctgcactcagtccccgccgacggcccctcgctgcgccccgccgtg
cgcagcaccgtccgctatctctgcgccacctggcggctgccctgctacgactggtgggag
gagcactccgaccaggtccacgtctcgacgctgacagccgtcgaggccggcctgcgcgcg
gccctgcgcaccggcctgctggacgacgacctggccgcgcaggcgacgagcgcggcctcg
tcgatcgccctggtggtggcccgcgagggaaccgtcgacgggcggctgcgcaagtggctc
ggctccgacgccgtcgacggcagcctcctcgcggcgttcgcgccgttcggggtcgtcgac
gccggcaccggagcccgcaccgtcgccgccgtcgagcgcgacctgctcgacggcggggga
gtacaccgcttccgggccgacgtgttctacggcggcggccgctggccggtcctggccgcg
ctgctcgggcacgcctacctggccctggaccgtcccgcggacgcgcggcgccagctcgcc
tggatcgccggcaccgccgcacccaacggcgacctgcccgagcaggtgagcgaccgcctc
cttgcgcccgaacaccggcaggagtggctggaccgctggggcccggtggcgacgccgctg
ctgtggtcgcacggcgcgttcctgtccctggccgcacgactgggagtcacggcatga

DBGET integrated database retrieval system