KEGG   Drosophila virilis: 6635708
Entry
6635708           CDS       T01066                                 

Definition
(RefSeq) chorion transcription factor Cf2 isoform X1
  KO
K02215  chorion factor 2
Organism
dvi  Drosophila virilis
Pathway
dvi04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dvi00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    6635708
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dvi03000]
    6635708
Transcription factors [BR:dvi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    6635708
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-CHCC zf-Di19 zf-C2H2_11 RskA zf-C2H2_6 zf-C2H2_jaz DUF4746 zf-C2HC_2 Otopetrin Mem_trans zinc_ribbon_9
Other DBs
NCBI-GeneID: 6635708
NCBI-ProteinID: XP_032293946
FlyBase: FBgn0203313
Position
Unknown
AA seq 554 aa
MLKSSTNTQELRLPRPEEHQPQPTHQVAAVIANNIKSASAAAAAAAAAAAAAAGSAGAGS
VPSGHSMDTLKTTFLPNLSMDPNVISPHYCPMCHQQFERTQHAAEHMQLCHGITLNAQPG
GIPSLEQQQQQQHQQQQQQQLKPLSFACSNCDDKFASPLEVDEHHRLTHQTVFLARCIVC
SIYGVNSVTQNPNEYKCSHCGAVCNAAMLAAGQQTFMEHQEAPVTPDDLPAMAPRDMRLT
PEEQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQEQQLQQQHQQEHHHQQLEQQQQQ
QQQQEQQRQRELQEQQHQEDLTDPATPKVPPLTVKLLKNGNGATVTHPQVIIKEEPLSLS
DSGDVVNAVPVYAIQANPGVQPAGTPGAGATSVLVSTQSVPADLAHKIRHKCPDCPKTFK
TPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFRCGYCGR
AFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQ
RSALTVHTTKLHPL
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgttaaagtctagcacaaacacacaggaattgcgtctgccacgccccgaggagcaccag
ccacagcccacgcatcaagttgccgccgtgatagccaacaatataaagtctgcatcagca
gcagcagcagcagcagcagccgcagcagccgcagcagcaggatcagcaggagcaggatca
gtcccttccggccatagcatggacacgcttaagacaacgtttctgcccaatctcagcatg
gatccgaacgtgatcagtccgcactactgccccatgtgccatcagcagttcgagcgcacc
cagcacgccgccgagcacatgcagctctgccatggcattacactcaacgcacagcccggc
ggtatacccagtctcgagcagcagcagcagcagcaacatcagcaacagcagcagcagcag
ctgaagccgttgagctttgcgtgttccaactgtgatgataagtttgctagcccgctggag
gtggacgagcaccatcggctgacgcatcagaccgtctttttggcgcgctgcatcgtttgc
agcatttatggcgtcaattctgtaacacagaatcccaacgaatacaaatgctctcactgt
ggtgccgtttgcaatgcggccatgctggccgccggtcagcaaacgtttatggagcatcag
gaggcgccggtgacgccggatgatctgccggccatggcgccgcgtgatatgagactgacg
cccgaggagcagcagcaccagcagcagcagcagcaacaacaacaacagcagcagcaacaa
caacaacaacaacaacagcagcaacagcaacaacaacaacagctgcaacaggagcaacaa
ttgcaacagcaacatcaacaggaacatcatcaccagcaactcgaacaacagcaacagcag
cagcaacaacaggagcagcagcgacaacgtgaactccaggagcaacagcatcaggaagac
ttgaccgatccggcaacgcccaaggtgccgccgctaacggtaaaactgctgaagaacggc
aacggcgcaacggtaacacatccccaggtgatcatcaaggaggagccactcagtttgagc
gacagcggcgatgtggtgaatgcggtgcctgtctatgccatacaagcgaatcctggcgtc
cagccggcgggcacacccggtgccggtgcaaccagcgtgctggttagcacgcaatcggtg
cccgcggatctggcgcataagatccggcataaatgtcccgattgtcccaaaacgtttaag
acgcccggcacgctggccatgcaccgcaagatacacacgggcgaagcagacgccacgccc
aaagaacgcccctacacgtgctcctactgcggcaagtccttcactcaatcgaatacacta
aaacagcacactcgcatacatacaggtgagaaaccatttagatgtggctattgtggcagg
gcgttcactgttaaggattacctgaacaaacatttaacgactcacacgggtgaaaaacca
tttcattgtggctactgtgagaagtccttcagcgttaaggactatctcacgaaacacata
cgcacacacaccggcgaaaagccgtacacctgtccgtactgtgacaaacgattcacgcaa
cgcagcgccttaaccgtgcacacgaccaagctgcatccgctctag

DBGET integrated database retrieval system