KEGG   Drosophila willistoni: 6644013
Entry
6644013           CDS       T01067                                 

Definition
(RefSeq) chorion transcription factor Cf2 isoform X1
  KO
K02215  chorion factor 2
Organism
dwi  Drosophila willistoni
Pathway
dwi04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dwi00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    6644013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dwi03000]
    6644013
Transcription factors [BR:dwi03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    6644013
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-Di19 zf-C2H2_11 zf-CHCC zf-C2H2_jaz zf-C2H2_6 DUF4757 zf-C2H2_2 Desulfoferrod_N zf-C2HC_2 zinc_ribbon_9 zf-C2HE
Other DBs
NCBI-GeneID: 6644013
NCBI-ProteinID: XP_002066622
FlyBase: FBgn0226552
UniProt: B4N0J5
Position
Unknown
AA seq 507 aa
MIKSTTNIQEQRLPRPEDQQQTPQTPTHPPPHPPPPHPVPTHQVAAVIANMDSLKTAFLP
NLSMDPNVLAPHYCPMCHQQFDRAQHATEHMQLCHGLNLNPQGAITTLEAAQHQQQQQQQ
QQQQQQQLKPSYPCSNCDEKYGSAVELDEHHRMSHQATAFLARCIVCTIYGVNSATQNPN
EYKCSHCGSVCTAAMLAAGQQSFMEQQEAPVTPDDMPAIAPRDMRLTPEEQHHQQQQLQQ
QQQEQHHQAHQQHQQQQHQQDDLTDAQVALKVPPLTVKLNKNSNNGGASHPQVIIKEEPL
SLSDSGDVVSSVPVYAIQANPGASGQPGGQPTTAAPGGGPGATTSVLVSTQTVAADLAHK
IRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIH
TGEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGEK
PYTCPYCDKRFTQRSALTVHTTKLHPL
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgataaaatctactaccaacatacaggaacagcgtctgccacgccccgaggatcaacaa
cagacgccgcagacgccaacacatccgcctcctcatcctccacctccgcatccagtgccc
acgcatcaagttgctgccgtaatagccaatatggactctttgaaaaccgcctttctgccc
aatctcagcatggatccgaatgtgcttgctccacactattgtcccatgtgtcatcagcag
tttgatcgtgcgcaacatgcgacagagcatatgcaactctgccatggcctcaatttaaat
ccccaaggagccattacaacgctggaggctgcgcagcaccagcaacagcagcagcagcaa
caacaacagcagcagcagcaactaaaacccagttatccttgtagcaattgtgatgaaaaa
tatggcagcgccgtagaactggacgagcatcatcggatgtcgcatcaggcgactgccttt
ctggcccgctgcattgtatgcaccatttatggtgtcaattcggccacacagaatcccaac
gaatacaagtgctcgcactgtggttccgtttgcaccgcagccatgttggcagcgggacag
caatcgttcatggagcagcaagaggcgccggtgacgcctgatgatatgccggccatagca
ccgcgtgatatgagactgacccccgaagagcagcatcaccaacagcaacaattgcaacaa
cagcagcaggagcaacatcatcaagcgcatcagcaacaccagcagcaacagcaccaacag
gacgacctcactgatgcccaggtggcgcttaaggttcctccgcttacagtcaaactgaac
aaaaatagcaacaatggcggcgcctcgcatccgcaggtcatcatcaaagaggaaccactc
agtctcagtgatagcggcgatgtggttagctctgttcccgtctatgccatacaagcgaat
cccggagccagcggccagccgggcggacaaccaacaactgctgcacctggcggaggaccc
ggagccacaacaagtgtcctggtcagcacgcaaacagtggccgctgatcttgcgcataaa
atacgacacaaatgtccggattgcccaaaaactttcaagacacccggcacgctggccatg
caccgtaaaatccacacaggcgaagcagacgccacgcctaaagaacgcccctacacgtgc
tcctactgcggcaagtccttcactcaatcgaatacactaaaacagcacactcgcatacat
acaggtgagaaaccatttagatgtggatattgtggcagggcgttcactgttaaggattac
ctgaacaaacatttaacgactcacacgggtgaaaagccgtttcactgtggatactgtgag
aagtcctttagcgttaaggactatctcaccaaacatatacggacacatacgggcgaaaag
ccgtatacctgtccgtattgtgacaagcgttttacgcaacgcagtgcactcaccgtgcat
acgacgaaactgcatccgctctag

DBGET integrated database retrieval system