KEGG   Drosophila yakuba: Dyak_GE14655
Entry
Dyak_GE14655      CDS       T01068                                 

Definition
(GenBank) uncharacterized protein, isoform A
  KO
K02215  chorion factor 2
Organism
dya  Drosophila yakuba
Pathway
dya04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dya00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dyak_GE14655
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dya03000]
    Dyak_GE14655
Transcription factors [BR:dya03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    Dyak_GE14655
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_2 zf-Di19 zf-C2H2_6 DUF4746 zf-CHCC zf-H2C2_5 zinc_ribbon_9
Other DBs
NCBI-ProteinID: EDW87687
FlyBase: FBgn0232250
UniProt: B4NZ23
Position
2L
AA seq 476 aa
MIKSTTNPQEQRLPRPEDQSPAPPPPPSSATSTAAPATPTHQVASVIANMDTLKTAFLPN
LSMDPNVHVSPHYCPMCHQQFERPQHVADHMQLCHGITLNAQGAIATLDGGHPQAQQHPK
LSHPCFNCDEKFSNAVDLDEHHRLAHQTSAFLARCLICSIYGIHSATQQPNEYKCTQCGS
ICTTAMLAAGQQGFMEQQEAAVTPDDQLPTMAPRDMRLTPEEQHHQQQLQAEHHHQQQHQ
QQQQQQELLEQQQREMQEQAQQQQVHHHQQDQDLAGDQVALKVPPLTVKLNKNANGGAIV
AHPQVIIKEEPLSLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIRH
KCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRIHTGE
KPFHCGYCEKSFSVKDYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVHTTKLHPL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgataaagtccaccacgaatccacaggaacagcgtctgccacgccccgaggatcagtcg
ccagcgccgccgccgcccccctcctcagccacctccaccgccgccccagccacgcccacg
caccaagtggcctccgtgatagccaacatggacaccctgaagaccgcctttctgcccaat
ctcagcatggaccccaatgtgcacgtgtcgccgcactattgtcccatgtgccaccagcag
ttcgagcggccacagcacgtagcggatcacatgcagctgtgccacgggatcacgctgaac
gcccaaggtgccatcgccacgctggacggtggccatccgcaggcacagcagcatcccaag
ctcagccacccctgcttcaattgtgatgaaaagtttagcaacgccgtcgatctggacgaa
caccatcgactggcccatcagacgtccgccttcctggcccgctgccttatatgcagcatc
tatggcatccactcggccactcagcagcccaacgagtacaaatgcacgcagtgcggctcc
atttgcaccaccgccatgctggccgccggacagcagggcttcatggaacagcaggaggcg
gcggtgacgcccgacgaccagctgccgacgatggcgccccgtgatatgagactgacgccc
gaggagcagcaccaccagcagcaactgcaggcggaacaccaccatcagcaacagcaccaa
caacagcagcagcagcaggaactgctggagcagcagcagcgtgaaatgcaggagcaggcg
caacaacagcaggtgcaccatcaccagcaggatcaggatctcgccggcgaccaggtggcg
ctaaaggtgccaccgctcaccgtcaagctaaacaagaacgccaacggtggcgccattgtg
gcccatccgcaggtcattatcaaggaggagccactcagcctgagcgatagtggtgatgtg
gtcaactctgtgcccgtctatgccatacaagccaatcccggtgtacccgctccggccagt
tcgggtgtgctagtcggcacgcaaacggtgcccgccgatttggcgcacaagatccgacac
aaatgcccggattgtccaaagaccttcaagacgcccggcacgctggccatgcaccgcaag
atacacacaggcgaagcagacgccacgcccaaagaacgcccctacacgtgctcctactgc
ggcaagtccttcactcaatcgaatacactaaaacagcacactcgcatacatacaggagag
aagccgttccactgcgggtactgcgagaagtccttcagcgtgaaggactatctgaccaag
cacatacggacgcacaccggcgagaagccgtacacctgtccgtactgtgacaagcgcttc
acgcagcgcagcgccctcactgtgcacacgaccaagctgcatccgctctag

DBGET integrated database retrieval system