KEGG   Exiguobacterium acetylicum: KKI46_02990
Entry
KKI46_02990       CDS       T07509                                 
Name
(GenBank) aldehyde dehydrogenase family protein
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
eace  Exiguobacterium acetylicum
Pathway
eace00623  Toluene degradation
eace01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eace00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    KKI46_02990
Enzymes [BR:eace01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     KKI46_02990
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: QWB30655
UniProt: A0A8E7ZQT1
Position
complement(572255..573739)
AA seq 494 aa
MAQQNEATLHTDFTKIYIDGQWRTGASDSNMTNTNPFTGEELFTISAANQQDLDDAYEAA
QVAQKDWAKVPALKRQGLIENFLKVLYEEKETIIEWLIKESGSTRIKAEGEFLASVLIVK
EAATFPLRMHGEIRPSVVPGKENRIYRKALGVIGVISPWNFPFHLAVRSIATAIAIGNAV
VVKPATDTPVSGGLIFASLFEKAGLPKGVLNVIVGRGSEIGDAIVEHPVPRLISFTGSTE
VGRHIGELAGKHLKKTALELGGNNVFVVLDDADLDRAVESAVYSKFYHQGQICMSTNRIL
VASSIHDEFVEKYVARVKELQYGDPSHERTQVGPLINQSQVERILEDLEKTKAAGATVRV
GGEAKDNVIAPTVVTGVTNDMPLAKNEIFGPVAVIIPFDTDEEALEIANSLPYGLSGAVH
GSSIERATAFALEVETGMIHINDQSVNDEPHMPFGGEKDSGLGRFNGEWVLEEFSTVQWL
SVMHDRRQYKPFFE
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggctcaacaaaacgaagctacattgcatacagatttcacgaaaatttatattgacggt
cagtggcgcacaggcgcaagtgacagcaacatgacgaacacgaatcctttcacgggtgaa
gagctcttcacgatctctgccgcgaaccaacaagatttagatgacgcatatgaagcggct
caagtcgctcaaaaagactgggcgaaagttcctgccttaaaacgccaaggcttgatcgaa
aacttcttgaaagtcttgtacgaggagaaagaaacgatcatcgaatggttgattaaagag
tccggaagtacacgtattaaagcggaaggcgaattccttgcttctgtcttgatcgtcaag
gaagctgcgacattcccacttcggatgcacggtgaaattcgtccatcggtcgtaccaggt
aaagaaaaccggatctaccgtaaagcacttggcgtcatcggtgtcatcagtccatggaac
ttcccgttccacttagctgtgcggtcgatcgctactgctattgccatcgggaacgcagtc
gttgttaaaccagctacggacacacctgtttcaggcggattgatttttgctagtctgttt
gaaaaagctggattgccaaaaggtgtcttgaatgtcatcgtcggtcgcggttcagaaatc
ggtgatgctatcgtcgaacatcctgtaccacgtttaatttcattcacaggatcaactgaa
gtaggtcgtcatatcggtgaacttgctggtaaacatctaaagaaaacagcgcttgaactt
ggcggaaacaacgtcttcgtcgtacttgatgatgctgatctcgatcgcgcggtcgaatct
gctgtctacagcaagttctatcaccaaggtcaaatttgtatgtcgacgaaccgaattctc
gtcgcttcttcgattcatgatgaatttgtcgagaaatacgttgctcgtgtaaaagagcta
caatacggtgatccatcacatgagcggacacaagtcggaccgctcatcaaccaatcacaa
gttgaacgaattcttgaagatctcgagaaaacaaaagctgcgggtgcaaccgttcgtgtc
ggcggcgaagcaaaagataacgtcatcgcacctactgtcgtgactggtgttacgaatgat
atgccactcgctaaaaatgaaatcttcggaccggttgctgtcatcatcccgttcgatacg
gatgaagaggcactcgaaatcgcgaactcacttccatacggattgagtggcgctgtccat
ggttcttctattgaacgcgcgactgcctttgcgcttgaagtcgagacaggtatgattcac
atcaacgatcaatcggtcaacgatgagccacatatgccatttggtggtgaaaaagattca
ggactcggtcgcttcaacggtgagtgggtacttgaagaattctcgactgtccaatggttg
tctgtcatgcacgatcgtcgtcaatacaaaccattcttcgagtaa

DBGET integrated database retrieval system