KEGG   Aromatoleum aromaticum: c1A100
Entry
c1A100            CDS       T00222                                 

Gene name
apc4
Definition
(GenBank) Related to alpha-subunit of acetone carboxylase, possible subunit of acetophenone carboxylase
  KO
K10701  acetophenone carboxylase [EC:6.4.1.8]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00642  Ethylbenzene degradation
eba01120  Microbial metabolism in diverse environments
eba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00642 Ethylbenzene degradation
    c1A100 (apc4)
Enzymes [BR:eba01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.8  acetophenone carboxylase
     c1A100 (apc4)
SSDB
Motif
Pfam: Hydantoinase_B
Other DBs
NCBI-ProteinID: CAI07447
UniProt: Q5P5G5
Structure
PDB: 
5L9W

Position
complement(1414604..1416658)
AA seq 684 aa
MAIPTLEQKLTWLKPAPASSRELDLAAQIDPAQFEIGFQRTNDILDEGMDVFVRSCRCAM
GVAGDSLVAIMTADGDIVNGSCGTYLHAVIPPLIIKYILETYGDEIRDGDLWFANDAVYG
GVHNPDQMVCMPVYYEGKLVAWTAALVHTTETGAIEPGGMPVSATTRFEEGMNLPPMRIG
ENFKLREDVVSMFVAFGLRAPSMIAVDLKARCTTADRVRTRIIELCEREGADYVTGLFRK
MLQVAEAGARELIEQWPDGKYRCVTFSDAVGLKQGLVRSCYMTLEKKGDRMLVDLSETGP
ETPSPYNAHPQAAIAHFSNYIYEYLFHSLPISNGTFANIDFKFGKNTCLSPDPRAATSCS
VMISTGVMSAVHNACAKAMFSTSLWKQSGASMGNGGNALVLAGQNQWGSSFADMLAYSIN
TEGQGARPTEDGMDAFGFPWCVFGRAPNTESVENEFPLLVPLSNHWKDSCGHGKYRGGVG
TAQVWVAHHVPELYMMAIADNTKLQTPQPLFGGYAPCTVPGIGIRNANIKELMAEGSDKI
KLDVETLLAERTIDGKYEIEFQGRSVRPYSNGEVVTFAFSCGGTGYGDPLDRDPKSVEVD
LLKGVLTEQTAQNIYKVKWDANLRRVDLDETSRLRAAEHDARRKRGVPYEQFEREWLKQR
PDDEILKYYGTWPDAKVAQPLLRA
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggctattcccacccttgaacagaaactcacctggctcaagcccgcgcccgccagctcg
cgcgaactcgacttggcggcgcagatcgatcccgcgcagttcgaaatcggcttccagcgc
accaacgacattctcgacgaaggcatggacgtgttcgtccgttcgtgccgctgcgcgatg
ggcgtcgctggtgactcgctggtcgcgatcatgaccgccgacggggacatcgtgaacggt
tcctgcggcacctacctgcacgcggtcatcccgccgctgatcatcaagtacatcctggag
acgtacggcgacgagatcagggacggcgacctgtggttcgcgaacgatgcggtgtacggc
ggcgtgcataacccggaccagatggtctgcatgccggtgtattacgaaggcaagctcgtc
gcctggaccgcagcgctcgtgcatacgaccgagaccggcgcaatcgagccgggcggcatg
ccggtgtcggcgacgacgcgcttcgaggaaggcatgaacctgccgccgatgcgcatcggc
gagaacttcaagctgcgcgaggacgtggtgtcgatgttcgtcgccttcggcctgcgtgct
ccgtcgatgatcgcggtcgacctcaaggcccgctgcaccactgcggaccgcgtgcgcacc
cgcatcatcgaactttgcgagcgcgagggtgccgattacgtgacggggctgttccgcaag
atgctgcaggtggccgaggccggcgcgcgcgagctgatcgagcagtggcccgacggcaag
taccgttgcgtgaccttcagcgacgcggtgggcctcaagcagggcctggtgcgttcctgc
tacatgacgctcgagaagaagggcgaccgcatgctggtcgacctgtccgaaaccgggccg
gaaacgccgtccccgtacaacgcccatccgcaggccgcgatcgcacacttctcgaactac
atctacgagtacctgtttcattcgctgccgatctccaacggcacctttgcgaacatcgac
ttcaagtttggcaagaacacctgcctgtcgcccgacccgcgtgcggcgacctcgtgttcg
gtgatgatctccaccggcgtcatgagcgcggtgcataacgcgtgcgccaaggcgatgttc
tccacctcgctgtggaagcagtcgggtgcgtcgatgggcaatgggggcaacgcactggtg
ctcgcgggccagaaccagtggggatcgtccttcgccgacatgctcgcgtattcgatcaac
accgagggccagggggcccggccgaccgaggacggcatggacgccttcggtttcccgtgg
tgcgtgttcggccgtgcgccgaacaccgagtcggtcgagaacgagttcccgctgctggta
ccgctgtccaatcactggaaggactcgtgcggccacggcaagtatcgcggcggcgtcggc
accgcccaggtgtgggtcgcgcaccatgtgccggagctgtacatgatggcgatcgccgac
aacaccaagctgcagaccccacagccgctgttcggcggctacgcgccctgcaccgtgccg
ggaatcggcatccgcaacgccaacatcaaggagctgatggccgaaggcagcgacaagatc
aagctcgacgtcgagacgctgcttgccgaacgcacgatcgacggcaagtacgagatcgag
ttccagggtcgttcggtgcgcccgtacagcaacggcgaagtcgtcactttcgcgttctcg
tgcggcggcaccggttacggcgacccgctcgaccgcgatccgaagtcggtcgaggtcgat
ctgctcaagggcgtgctgaccgagcagaccgcgcagaacatctacaaggtgaagtgggac
gccaatctgcggcgcgtcgatctcgacgagaccagccgtctgcgcgccgcggagcacgac
gcgcggcgcaagcgcggcgtgccttacgagcagttcgagcgcgagtggctcaagcagagg
ccggatgacgagatcctgaagtactacggcacctggcccgatgcgaaggttgcgcaaccg
ctgttgcgcgcataa

DBGET integrated database retrieval system