KEGG   Aromatoleum aromaticum: c1A200
Entry
c1A200            CDS       T00222                                 
Symbol
apc2
Name
(GenBank) Related to gamma-subunit of acetone carboxylase, possible subunit of acetophenone carboxylase
  KO
K10701  acetophenone carboxylase [EC:6.4.1.8]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00642  Ethylbenzene degradation
eba01120  Microbial metabolism in diverse environments
eba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00642 Ethylbenzene degradation
    c1A200 (apc2)
Enzymes [BR:eba01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.8  acetophenone carboxylase
     c1A200 (apc2)
SSDB
Motif
Pfam: Acetone_carb_G DZR DUF3725 YhfH DUF4428
Other DBs
NCBI-ProteinID: CAI07449
UniProt: Q5P5G3
Structure
Position
complement(1418880..1419269)
AA seq 129 aa
MYERIRFTEYLDLDLNDEHWYCHDCGTKLISARESYKKGCLVAERRPHEIHNPVIEGEYS
FAPDENWVRILEFYCPGCTRQIETEYLPPGHPITVDIEVDIDSLKARLKKGVIVIKDGKL
TKPEAEVLA
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtatgaacgcatccgattcaccgagtacctcgatctcgacctcaacgacgagcattgg
tactgccatgactgcggcaccaagctgatctcggcccgcgaaagctacaagaagggctgc
ctggtcgccgaacgccgcccgcacgagatccacaacccggtgatcgagggtgaatacagc
ttcgcacccgacgaaaactgggtccgcatcctggagttctactgccccggctgcacgcgc
cagatcgaaaccgaatacctgccgccgggccacccgatcacggtcgatatcgaggtggat
atcgacagcctcaaggcccgcctgaagaagggggtcatcgtgatcaaggacggaaaactg
accaagcccgaagcggaggtgctggcatga

DBGET integrated database retrieval system