KEGG   Aromatoleum aromaticum: ebA3161
Entry
ebA3161           CDS       T00222                                 
Symbol
pchA
Name
(GenBank) P-hydroxybenzaldehyde dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00623  Toluene degradation
eba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    ebA3161 (pchA)
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     ebA3161 (pchA)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: CAI07900
UniProt: Q5P463
Position
1887469..1888941
AA seq 490 aa
MKSKPAYQNLELQPIAGQWRAGSAERNLDVTDPFTGKTLLSLPMASCEDLDQAYHAAQKA
QSEWATMGPTVRGDVMRRAVEIFDERKEEILHWLIRESGSTHIKAEIEWASARAITLESA
SLPSRVHGRILPSDVPGKESRVYRAPLGVVGVISPWNFPLHLSARSVSPALALGNAVVIK
PASDTPITGGLLLARIFEEAGLPAGVLSVLVGAGSDIGDAFVEHPVPSFISFTGSTPVGR
NIGRLASGGTHLKHVALELGGNSPFVVLADADVDAAVNAAVVGKFLHQGQICMAINRIIV
EAPLLEGFTRRFVERVKALPYGDPSKPETIVGPVINAKQLAGLTAKISKAQQEGAVVLVG
GDPQGNVMPPHVFGNVTADMEIAREEIFGPLVGIQSARDAEHALTLANSSEYGLSSAVFT
GDTSRGVQFAQRIRAGMTHINDMPVNDEPNAPFGGEKNSGLGRFNGDWAIEEFTTDHWVT
VQHAPRRYPF
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgaagagcaagccggcctatcaaaaccttgaattgcagccgattgccgggcagtggcga
gcgggaagcgccgaacgcaatctcgatgtcaccgaccctttcaccggcaaaaccctgctg
agcctgccgatggccagttgtgaggatctggaccaggcttatcatgcggcgcaaaaggcg
caatccgaatgggcaacaatggggcccacggtgcgtggtgacgtaatgcgtcgggccgtc
gaaattttcgatgagcgcaaggaagaaatcctccactggctgattcgtgagtccggcagt
acccacatcaaggccgaaatcgagtgggcttccgcccgcgccatcacgctggagtccgcg
agcctgccgagccgggttcatggccgcattttgccttcggatgtgccgggcaaggaaagc
cgtgtctaccgcgcgccgctgggtgtggtaggagtgatcagtccctggaactttccgctg
cacttgagtgcccgttcagtctccccggcgctggcgctgggcaacgccgtggtcatcaaa
ccggcgagtgatacgccgatcaccggcggcctgctgctggcgcgcatcttcgaggaagcc
gggctgccggcaggcgtgttgagtgtgctggttggggccggctcggacatcggcgatgcc
ttcgtcgagcacccggtgccgtccttcatctcctttaccggctccacgcccgtcggccga
aacatcggccgtcttgcgagcggcggcacgcacctcaagcacgtggcgctggaactgggc
ggcaacagtccgtttgtggtgctggccgatgcggatgtggatgcggcggtgaacgctgcg
gtggtcggcaagttcctgcaccaggggcaaatctgcatggccatcaaccgcatcatcgtt
gaagcccctctgctggaagggttcacacggcgctttgtcgagcgggtcaaggcattgccg
tatggcgatccgagcaagccggaaaccattgtgggcccggtgatcaacgccaaacagctg
gcaggcctcacggccaaaatcagcaaggcgcaacaggaaggtgcagtggtcctcgtgggc
ggcgacccgcaaggcaacgtcatgccgccgcatgtattcggcaacgtgaccgccgatatg
gaaatcgcccgcgaggagatcttcggcccgctggtcggcatccagagcgcccgcgacgcg
gagcatgcactgaccttggccaatagcagcgagtacgggctgtccagcgccgtgttcact
ggggatacctcccgtggcgtgcagttcgcgcagcggatccgtgccggcatgactcatatc
aacgatatgccggtcaacgacgagccaaacgcacccttcggcggcgagaagaattctggc
ttggggcggttcaacggtgactgggcaatcgaggagttcacgacggatcactgggtcacg
gtgcagcacgcgccgcgtcgctatccgttctga

DBGET integrated database retrieval system