KEGG   Erigeron canadensis (horseweed): 122602419
Entry
122602419         CDS       T07610                                 
Name
(RefSeq) beta-amyrin 28-monooxygenase-like
  KO
K22620  beta-amyrin 16beta-monooxygenase [EC:1.14.14.63]
Organism
ecad  Erigeron canadensis (horseweed)
Brite
KEGG Orthology (KO) [BR:ecad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ecad00199]
    122602419
Enzymes [BR:ecad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.63  beta-amyrin 16beta-monooxygenase
     122602419
Cytochrome P450 [BR:ecad00199]
 Cytochrome P450, plant type
  CYP716 family
   122602419
SSDB
Motif
Pfam: p450 ABC2_membrane_3
Other DBs
NCBI-GeneID: 122602419
NCBI-ProteinID: XP_043631038
Position
5:complement(35243511..35245799)
AA seq 479 aa
MDPLLLICSILLPIVAIFVLNFLLTAKSNVPGHFSFPVVGESIDYFKKLRSGTNEKFVMQ
RKKKFGDVFKASVLGEQMAFLCGPEGNKFLFSQENKLVEVWWPSSVESIMKKSHNKSVIA
ESAKVRQLLPPFLKANAVKNYVGDMDKELRQHLKDYWIGHDKVEVCPFVAKYTFALAVKL
LLGVRDPTELEKLAKPFVDAAGGIIAVPINIPGTRFNRGVKASNRIREVINGIIAQRRKD
LANGIANPSQDLLSHMIVEVDKRNQDPINAPTTDGDISSDLLGLLIGGYDTINTTVVFIM
MTLVDHPDVYEAVLKEQMEIAKGKEPGELLNWEDLRKMKYSWNVACEVLRMRPPTVGAFR
VAKKDFTYAGYKIPKGWKLHYIPHYTQKNPEFFPNPEIFDPSRFEGDGPAPYTYVPFGGG
PRMCPGNEYARAEILVFMYNIVTRYNWEMLIPGEKVVIDPLPRPVHGLPIKLIPHKAQA
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggatcccctgctgctaatttgctctatacttttgcccattgtcgcaatttttgttctc
aactttttacttaccgcaaaatcaaacgttccgggccactttagcttcccagtagtcggt
gaaagcatcgactacttcaagaagctaagaagtggcacgaacgagaagtttgtgatgcaa
agaaaaaaaaaatttggggacgtatttaaagcatcggtcctcggtgaacaaatggcgttt
ttgtgtggccctgaaggcaacaagttcttgttttctcaagaaaacaagcttgttgaagta
tggtggccgagttcggtggagagtattatgaagaagtcgcataataagtctgttattgct
gagtcagctaaggtgcgacaattgttgccacctttcttgaaagcaaatgctgtcaagaat
tatgttggagatatggataaagagttgagacaacatttgaaagattactggattggccat
gataaggttgaggtatgcccattcgttgcaaagtacacatttgccttggccgtgaaattg
cttttaggggtgcgcgatccgactgagttagagaagctcgcaaagccgtttgtggatgca
gcaggtggaatcattgcggtcccaatcaacattccaggaacaaggttcaaccgtggagtt
aaagcatcaaacagaattcgagaagtcataaacggcataattgcccaaagaagaaaggac
cttgctaatggaattgccaatccatctcaagatcttttgtctcacatgattgtcgaggtt
gataaaaggaatcaggatcccattaacgctcccacaacggacggtgacatatctagtgac
ttactagggttgctcatcggtggttacgacactatcaacaccacggtcgtgtttattatg
atgactctcgtcgatcaccctgacgtgtacgaagcagtactaaaagagcaaatggagata
gcaaaagggaaagagcccggtgaactattgaattgggaagacttgcgtaaaatgaagtac
tcatggaatgtcgcgtgtgaagtgctaaggatgcgtcctccaactgttggggcttttcgt
gttgcgaaaaaggacttcacttatgctggttacaaaattcccaaaggatggaagctacat
tacatcccacattacacgcaaaagaaccctgaattcttcccaaaccctgagatatttgac
ccctcgagatttgaaggagatgggcccgcaccttacacgtacgtgccatttggaggcggt
ccaagaatgtgccccggaaacgagtatgcaagggcagaaatattggtgtttatgtacaac
atagtaacaagatacaattgggaaatgctaattccaggtgaaaaggtagtaattgaccca
cttccaaggcccgttcatgggcttccaattaagctcattccacataaggcccaagcttga

DBGET integrated database retrieval system