KEGG   Equus caballus (horse): 100051272
Entry
100051272         CDS       T01058                                 

Gene name
ELOVL7
Definition
(RefSeq) elongation of very long chain fatty acids protein 7 isoform X1
  KO
K10250  elongation of very long chain fatty acids protein 7 [EC:2.3.1.199]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100051272 (ELOVL7)
   01040 Biosynthesis of unsaturated fatty acids
    100051272 (ELOVL7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100051272 (ELOVL7)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100051272 (ELOVL7)
Lipid biosynthesis proteins [BR:ecb01004]
 Elongase
  PUFA
   100051272 (ELOVL7)
SSDB
Motif
Pfam: ELO
Other DBs
NCBI-GeneID: 100051272
NCBI-ProteinID: XP_023481409
Ensembl: ENSECAG00000007176
VGNC: 17543
Position
21
AA seq 281 aa
MAFSDLTSRTMRLYDNWIKHADPRVEDWLLMSSPLPQTIILVLYVYFVTSLGPKLMENRK
PFDLKKVMITYNFFIVLFSVYLCYEFVMSGWGTGYSLRCEIVDYSWSPTALRMARTCWLY
YFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAV
HVVMYSYYGLCALGPAYQQYLWWKKYLTSLQLVQFLIVTIHVSQFFFMEDCKYQFPVFLY
IIMSYGCIFLLLFLHFWYRAYTKGQRLPKTMKNGICKNKDH
NT seq 846 nt   +upstreamnt  +downstreamnt
atggccttcagtgatcttacgtcgaggaccatgcgtctttatgataattggatcaaacat
gctgatccaagagttgaagactggctcctcatgtcctcgcctctgccacaaaccatcatc
ctggtactctatgtctattttgtcacttctctgggaccaaagctcatggagaatcgaaag
ccctttgacctcaagaaagtgatgataacgtacaattttttcatagtactcttttctgtg
tatctgtgttatgagtttgtgatgtctggctggggtacaggttattcattacgatgtgaa
attgttgactattcatggtcacccacagctttgaggatggcacgcacctgctggctttat
tacttctccaaatttatcgagctgttagatactatcttttttgttctgcgtaagaaaaat
agccaagtgactttcctgcacgtcttccatcataccatcatgccatggacctggtggttt
ggagtcaaatttgctgcaggtggtttgggaacattccatgcctttctaaatacagctgta
catgtagtcatgtattcttactatggactgtgtgcattgggaccagcttaccagcagtat
ttgtggtggaaaaaatatttgacatcattacagcttgtccagttccttattgtcaccatc
cacgtaagccagttctttttcatggaggattgcaagtaccagtttccggtctttctgtac
atcattatgagttatggatgcatctttctgctgctctttctccatttttggtaccgtgct
tacaccaaaggtcagaggctgcccaaaactatgaaaaatggaatctgcaaaaacaaagat
cattga

KEGG   Equus caballus (horse): 100053305
Entry
100053305         CDS       T01058                                 

Gene name
ELOVL1
Definition
(RefSeq) elongation of very long chain fatty acids protein 1
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100053305 (ELOVL1)
   01040 Biosynthesis of unsaturated fatty acids
    100053305 (ELOVL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100053305 (ELOVL1)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100053305 (ELOVL1)
Lipid biosynthesis proteins [BR:ecb01004]
 Elongase
  PUFA
   100053305 (ELOVL1)
SSDB
Motif
Pfam: ELO
Other DBs
NCBI-GeneID: 100053305
NCBI-ProteinID: XP_001498598
Ensembl: ENSECAG00000014743
VGNC: 17538
UniProt: F7DSS8
Position
2
AA seq 279 aa
MEAVVNLYQEMMKCADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRS
FMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNNPEALRMVRVAWLFLFSKFI
ELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVVMYL
YYGLSAIGPAAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMPSCNYQYPVIIHLIWMYG
TIFFGLFSNFWYQSYTKGKRLPRVLQQNGVPGTAKVKAN
NT seq 840 nt   +upstreamnt  +downstreamnt
atggaggctgttgtgaacttgtaccaggagatgatgaagtgtgcagatccccggatccag
ggctaccctctgatggggtctcccctgctaatgacctccatcctcctgacttatgtgtac
ttcgttctctcacttggacctcgaatcatggccaatcggaagcccttccagctccgcagc
ttcatgatcgtctacaacttctcactagtggccctctccctctacattgtctatgagttc
ctgatgtctggctggctgagtacctacacctggcgctgtgaccctgtagactattccaac
aaccccgaggcactgaggatggttcgagtggcctggcttttcctcttttccaagttcatt
gagctgatggacacggtgatctttattcttcggaaaaaagatggacaggtgaccttccta
catgtcttccaccactcagttcttccctggagctggtggtggggggtcaaaattgcgcca
ggaggaatgggctctttccacgccatgataaattcctctgtgcatgtcgtcatgtacctg
tactatggattgtctgccatcggccctgcggctcagccctacctttggtggaaaaagcac
atgacagccatccagctgatccagtttgtcctggtctcactgcacatctcccaatactac
ttcatgcccagctgtaactaccaatatccggtcatcatccacctcatctggatgtatggt
accatcttcttcggtctcttctccaatttctggtatcagtcttacaccaaaggcaagcgg
ctgccacgtgtacttcagcaaaatggagttccaggtaccgccaaggtcaaggccaattga

KEGG   Equus caballus (horse): 100060081
Entry
100060081         CDS       T01058                                 

Gene name
ELOVL3
Definition
(RefSeq) elongation of very long chain fatty acids protein 3 isoform X1
  KO
K10248  elongation of very long chain fatty acids protein 3 [EC:2.3.1.199]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100060081 (ELOVL3)
   01040 Biosynthesis of unsaturated fatty acids
    100060081 (ELOVL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100060081 (ELOVL3)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100060081 (ELOVL3)
Lipid biosynthesis proteins [BR:ecb01004]
 Elongase
  Unclassified
   100060081 (ELOVL3)
SSDB
Motif
Pfam: ELO ELMO_CED12
Other DBs
NCBI-GeneID: 100060081
NCBI-ProteinID: XP_001499193
Ensembl: ENSECAG00000023578
VGNC: 17539
Position
1
AA seq 270 aa
MVTAMNVSEETGQVLQPYNFELFQDMRPFLEEYWAASFLVVLIYLLLIFVGQNYMKARKG
FSLRGPLILWSFCLAVFSILGAVRTWSHMGILLLRGNLGQTVCFSSHIQDPVVRCWSCLF
LFSKIIELGDTAFIILRKRPLSFVHWYHHSTVLLYTSYGYKDKVSSGAWFMTMNYGVHAI
MYTYYTLKAAKVTAPRWLPMLITSLQILQMFMGAFVSILNHIWRQDPGCHSTSKQLFWSC
VLYMTYFILFARFFHQTYLMPKVKAKTKSQ
NT seq 813 nt   +upstreamnt  +downstreamnt
atggtcacagccatgaatgtgtcagaggaaacagggcaggtgttacagccctacaacttt
gagctgttccaggacatgaggccctttttggaggagtactgggcagcctcattcctcgta
gttctgatctacctgctgctcatctttgtggggcagaactacatgaaggcacggaagggc
ttcagcctgcgggggcctctcatcctttggtccttctgccttgcagtcttcagcatcctg
ggggcagtgaggacatggagccatatggggatcctgctactcagggggaacctaggtcaa
actgtgtgcttctccagccacatccaagatcccgtagtcagatgctggtcctgcctcttt
cttttcagcaagatcattgaacttggagacacggccttcatcatcctgcgtaagcggcca
ctcagctttgtgcactggtaccaccacagcacagtgctgctgtacacgagctatggatac
aaggacaaagtgtcttcaggcgcctggttcatgaccatgaactacggtgtgcacgccatc
atgtacacctactacactctgaaggctgccaaagtaacagctcccaggtggttgcccatg
ctcatcaccagcctgcagatcctgcagatgtttatgggagcctttgttagcatcctgaat
cacatctggagacaggatccgggatgccacagcacatcgaaacagctcttctggtcctgc
gtcttgtatatgacctatttcatcctctttgcccgcttcttccatcaaacctacctaatg
cccaaggtcaaagccaagaccaagagccaatga

KEGG   Equus caballus (horse): 100063624
Entry
100063624         CDS       T01058                                 

Gene name
ELOVL2
Definition
(RefSeq) elongation of very long chain fatty acids protein 2 isoform X1
  KO
K10205  elongation of very long chain fatty acids protein 2 [EC:2.3.1.199]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100063624 (ELOVL2)
   01040 Biosynthesis of unsaturated fatty acids
    100063624 (ELOVL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100063624 (ELOVL2)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100063624 (ELOVL2)
Lipid biosynthesis proteins [BR:ecb01004]
 Elongase
  PUFA
   100063624 (ELOVL2)
SSDB
Motif
Pfam: ELO
Other DBs
NCBI-GeneID: 100063624
NCBI-ProteinID: XP_023480223
Position
20
AA seq 296 aa
MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVIYLLSIWLGNKYMKNRP
ALSLRGILTSYNLGITLLSLYMLVELVLSSWEGGYNLQCQDLASAGEADIRVAKVLWWYY
FSKLIEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIH
ILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSS
YMLTLVILFLNFYVQTYRKKPVKKDMEDPPAGKEVKNGFSKAYLTAANGVIGKKAQ
NT seq 891 nt   +upstreamnt  +downstreamnt
atggagcatctaaaagcctttgatgatgaaattaatgcttttttggacaatatgtttgga
cctcgagattctcgagtcagaggatggttcatgttggactcttaccttcctacctttttc
cttactgtcatatatctgctttcaatatggctgggtaacaaatatatgaagaacaggcct
gctctttccctcagaggtattctcacctcgtataatctcggaatcacacttctctcccta
tatatgctggtagagcttgttctctccagttgggaaggaggctacaacttacagtgtcag
gatcttgccagtgcgggcgaagctgatatccgggtggccaaggtgctgtggtggtactac
ttctccaaattaatagagttcctggacacaattttctttgttttgcggaaaaaaaccagt
cagattacttttcttcatgtataccatcatgcgtcgatgttcaacatctggtggtgtgtt
ctgaactggataccttgtggacaaagtttctttggacccacactgaacagttttatccac
attctcatgtactcctactatgggctgtctgtgtttccgtctatgcacaagtacctttgg
tggaagaaatatctcacgcaggctcagctggtgcagtttgtgctcaccattacgcatacc
atgagtgctgtcgtgaaaccgtgtggcttccccttcggctgtctcatcttccagtcttcg
tacatgcttacattagtcatcctattcttaaatttttatgttcagacataccgaaaaaag
ccagtgaagaaagacatggaggatccacctgcagggaaagaagtgaagaatggtttttcc
aaagcctacttgaccgcagcgaacggagtgatcggcaagaaggcacagtaa

KEGG   Equus caballus (horse): 100069400
Entry
100069400         CDS       T01058                                 

Gene name
ELOVL5
Definition
(RefSeq) elongation of very long chain fatty acids protein 5 isoform X2
  KO
K10244  elongation of very long chain fatty acids protein 5 [EC:2.3.1.199]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100069400 (ELOVL5)
   01040 Biosynthesis of unsaturated fatty acids
    100069400 (ELOVL5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100069400 (ELOVL5)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100069400 (ELOVL5)
Lipid biosynthesis proteins [BR:ecb01004]
 Elongase
  PUFA
   100069400 (ELOVL5)
SSDB
Motif
Pfam: ELO
Other DBs
NCBI-GeneID: 100069400
NCBI-ProteinID: XP_014589981
Ensembl: ENSECAG00000014755
VGNC: 17541
UniProt: A0A3Q2I0Q8
Position
20
AA seq 299 aa
MENFDASLSPYFRALLGPRDTRVKGWFLLDNYIPTFICTAIYLLVVWLGPKYMRTRQPFS
CRGILVVYNLGLTLLSLFMFYELVTGVWENNYNFFCQGTRSAGEADMKIVEVLWWYYFSK
LIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLM
YSYYGLSSIPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMI
SLIALFTNFYIQTYNKKSASRRKERLREHQNGSVAAVNGHTTSFSSLENNVKLRKQRKD
NT seq 900 nt   +upstreamnt  +downstreamnt
atggaaaattttgatgcatcactgagtccctatttcagggctttgctgggcccccgagat
accagagtaaaaggatggtttcttctggacaattatatacctacttttatctgcactgcc
atatacctactagttgtatggctgggaccaaaatacatgaggacgaggcagccgttctct
tgccggggaattttagtggtgtataaccttggactcacattgctgtctctctttatgttc
tatgagttagtgacaggagtatgggaaaacaattacaacttcttctgtcaaggcacacgc
agcgcgggagaagcagatatgaagatcgtcgaagtcctctggtggtactacttctccaaa
ctcatcgagttcatggacaccttcttcttcatcttgcgcaagaacaaccaccagatcacg
gtcctgcacgtgtaccaccacgccaccatgctgaacatctggtggtttgtcatgaactgg
gtcccctgtggccactcttattttggtgccacactgaacagcttcatccatgtcctcatg
tactcgtactatggtctgtcgtccatcccttccatgcgtccgtacctttggtggaagaag
tacatcactcaggggcagctgcttcagtttgtgctgacaatcatccagaccagctgtggg
gtcatctggccgtgtacgttccctctcggttggttgtatttccagattggatacatgatt
tctctgattgctctcttcacaaacttctacattcagacctacaacaagaagagcgcctct
cggaggaaagagcgcctcagggagcaccagaacgggtcggtggccgccgtgaatggacac
accaccagcttttcctccctggagaacaatgtgaagctgaggaagcagcggaaggattga

KEGG   Equus caballus (horse): 100069512
Entry
100069512         CDS       T01058                                 

Gene name
ELOVL4
Definition
(RefSeq) elongation of very long chain fatty acids protein 4
  KO
K10249  elongation of very long chain fatty acids protein 4 [EC:2.3.1.199]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100069512 (ELOVL4)
   01040 Biosynthesis of unsaturated fatty acids
    100069512 (ELOVL4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100069512 (ELOVL4)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100069512 (ELOVL4)
Lipid biosynthesis proteins [BR:ecb01004]
 Elongase
  PUFA
   100069512 (ELOVL4)
SSDB
Motif
Pfam: ELO YWFCY SLATT_4
Other DBs
NCBI-GeneID: 100069512
NCBI-ProteinID: XP_001503697
Ensembl: ENSECAG00000022969
VGNC: 17540
UniProt: F6VSU8
Position
10
AA seq 314 aa
MGLLDAEPGSVLNVVSTALNDTVELYRWTCSFADKRVENWPLMQSPWTTLGISTLYLLFV
WLGPKWMKDREPFQMRLVLIIYNFGMVFLNLFIFRELFMGSYNAGYSYICQTVDYSDNVH
EVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ
AFFGAQMNSLIHVIMYSYYGLSAFGPWIQKYLWWKRYLTMLQLIQFHVTIGHTALSLYTD
CPFPKWMHWALIVYSISFILLFLNFYVRTYNMPKKSQTGKPAVNGISANGVSKSEKQLVM
ENGKKQKTGKAKGE
NT seq 945 nt   +upstreamnt  +downstreamnt
atggggctcctggacgcggagccaggcagtgtcctgaacgtggtgtccacggcgctcaac
gacaccgtggagttgtaccgctggacctgttctttcgcagataagcgtgtggaaaactgg
cctctgatgcagtccccatggactacgcttggtatcagcactctttatctcctgttcgtg
tggctgggtccaaaatggatgaaggaccgagagccttttcagatgcgcttagtgctcatt
atctataattttggcatggttttccttaacctttttatcttcagagagttattcatggga
tcatataatgcaggatatagctatatttgccagactgtggattattctgataatgttcac
gaagtcaggatagctgctgctctgtggtggtactttgtgtctaaaggagtggagtattta
gacacggtgttttttatcttgaggaagaaaaacaatcaagtctctttccttcatgtatat
catcactgtacaatgtttacgttgtggtggattggaattaagtgggtcgcagggggacaa
gcttttttcggagcccagatgaattccctcatccatgtgattatgtactcctactacggc
ttaagtgcgtttggcccatggattcagaagtatctttggtggaaacgatacctgactatg
ttgcagctgatccagttccatgtgaccattggccacacagcactgtctctgtacacggat
tgccctttccccaaatggatgcactgggctctcattgtctattcaatcagcttcatactt
ctctttcttaacttctatgttcggacatacaacatgcctaagaaatcccaaactggaaaa
ccagctgtgaatggtatttcagcaaatggtgtgagcaaatcagaaaaacagctagtgatg
gaaaatggaaaaaagcagaaaactggaaaagcaaaaggagagtaa

KEGG   Equus caballus (horse): 100072829
Entry
100072829         CDS       T01058                                 

Gene name
ELOVL6
Definition
(RefSeq) elongation of very long chain fatty acids protein 6
  KO
K10203  elongation of very long chain fatty acids protein 6 [EC:2.3.1.199]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100072829 (ELOVL6)
   01040 Biosynthesis of unsaturated fatty acids
    100072829 (ELOVL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100072829 (ELOVL6)
Enzymes [BR:ecb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     100072829 (ELOVL6)
Lipid biosynthesis proteins [BR:ecb01004]
 Elongase
  PUFA
   100072829 (ELOVL6)
SSDB
Motif
Pfam: ELO SF3A3
Other DBs
NCBI-GeneID: 100072829
NCBI-ProteinID: XP_005607948
Ensembl: ENSECAG00000010720
VGNC: 17542
UniProt: A0A3Q2HE08
Position
2
AA seq 265 aa
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR
TPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQSFYNGPISKFWAYAFVLSK
APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNFSVHALMYSY
YALRAAGFRVSRKFAMFITLSQITQMLVGCVVNYLVYYWMQHDQCYSHFQNIFWSSLMYL
SYLVLFCHFFFEAYMGKMRKIRKTE
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaacatgtcagtgttgactttacaagaatatgaattcgaaaagcagttcaacgagaat
gaagccatccaatggatgcaggaaaactggaagaaatctttcctgttctccgccctgtac
gctgccttcatctttggtggtcggcacctaatgaacaagcgggccaagtttgagctgagg
acgccgttagtgctctggtctctgacccttgctgtcttcagtatattcggtgctcttcga
actggtgcttatatggtgtacattttgatgaccaaaggcctgaagcagtcagtttgtgac
cagagtttttacaatggacctatcagcaagttctgggcttacgcctttgtgctaagcaaa
gcacccgaactaggagatacaatattcattattctgaggaagcagaagctgatcttcctg
cactggtaccaccacatcactgtgctcctgtactcctggtactcctacaaggacatggtc
gccgggggtggttggttcatgaccatgaacttcagcgtgcacgccttgatgtactcttac
tatgccctgcgagcggctggtttccgagtctctcggaagtttgccatgttcatcaccttg
tcccagatcacgcagatgctggtaggctgtgtcgttaactacctggtctactactggatg
cagcatgaccagtgttactctcactttcagaacatcttctggtcctcactcatgtacctc
agctaccttgtgctcttctgccacttcttctttgaggcctacatgggcaagatgaggaaa
atcaggaagactgaatag

DBGET integrated database retrieval system