KEGG   Equus caballus (horse): 100053192
Entry
100053192         CDS       T01058                                 

Gene name
HACD3
Definition
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 isoform X2
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100053192 (HACD3)
   01040 Biosynthesis of unsaturated fatty acids
    100053192 (HACD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100053192 (HACD3)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     100053192 (HACD3)
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100053192 (HACD3)
SSDB
Motif
Pfam: PTPLA CS
Other DBs
NCBI-GeneID: 100053192
NCBI-ProteinID: XP_001497867
Ensembl: ENSECAG00000023082
VGNC: 18679
UniProt: F6VAN8
Position
1
AA seq 362 aa
MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE
FLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL
RAKEEERLNKLRLESQGSPETLTSLKKGYLFMYNLVQFLGFSWIFVNMTVRFFILGKESF
YDTFHTMADMMYFCQMLSVVETINAAIGVTKSPVMPCLIQLLGRNFILFIIFGTMEEMQN
KAVVFFVFYTWSTVEIFRYPFYMLSCIDMDWKVLTWLRYTVWIPLYPLGCLAEAVSVIQS
IPVFNETGRFSFTLPYPVKIKVRFSFFLQIYLIILFLGLYVNFRHLYKQRRRRYGQKKKK
IH
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggagaatcaggtgctgacgccgcacgtctactgggctcagcgacaccgcgagctgtat
ctgcgcgtggagctgagtgacgtgcagaatcctgccataagcatcactgaaaatgtgctg
catttcaaagctcagggacacggtgccaaaggagacaatgtctatgaatttcacctggag
ttcctagaccttgtgaagccagagccggtttacaaactgacccagaggcaggtaaacatt
acggtacagaagaaggtgagtcagtggtgggaaagactcaccaagcaggagaagcgccca
ctgtttttggcccctgactttgaccgctggctggacgagtctgatgcagaaatggagctc
agagccaaggaagaagaacgcctaaataaactcagactggaaagccaaggctctcctgaa
actcttacaagcttgaagaaaggatacctattcatgtataatcttgttcagttcttggga
ttctcctggatatttgtcaacatgactgtgcggttctttatcttgggaaaagagtccttc
tatgacacattccacaccatggctgacatgatgtatttctgccagatgctgtcagttgtg
gaaaccatcaatgcagcaattggagtcactaagtcaccagtgatgccttgtcttatacag
cttcttggaagaaatttcattttgtttatcatctttggcaccatggaagaaatgcaaaac
aaagctgtggttttctttgtgttttatacatggagcacagttgaaattttcaggtacccc
ttctacatgctttcatgcattgacatggattggaaggtgctcacatggcttcgttacact
gtgtggattcccctgtatcctctgggatgtttggcagaagctgtctcggtgatccagtcc
attccagtgttcaatgaaacaggaagattcagtttcacattgccatatccagtgaaaatc
aaagttagattttccttttttcttcagatttatcttataatattatttttagggttatac
gtaaatttccgtcacctttataaacagcgcaggcggcgctatggacaaaaaaagaaaaag
attcactaa

KEGG   Equus caballus (horse): 100064435
Entry
100064435         CDS       T01058                                 

Gene name
HACD4
Definition
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100064435 (HACD4)
   01040 Biosynthesis of unsaturated fatty acids
    100064435 (HACD4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100064435 (HACD4)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     100064435 (HACD4)
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100064435 (HACD4)
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 100064435
NCBI-ProteinID: XP_001495396
Ensembl: ENSECAG00000000343
VGNC: 18680
UniProt: A0A3Q2HZS3
Position
23
AA seq 232 aa
MGSTAHPAWLQPRYRRNIYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLV
MRLCQSVSLLELLHICVGIESNHLLPRFLQLTERIIILFVVITSQEEVQGKYVVCVLFFF
WNLLDMVRYTYSMLSVIGISYAILTWLSQTLWMPVYPLCVLAEAFAVYQSLPYFESFGTY
STTLPFDLSIYFPYVLKIYLMMLFIGMYFTYSHLYSERSDMLRVFPIKKRKI
NT seq 699 nt   +upstreamnt  +downstreamnt
atggggtccacggcgcaccccgcctggctgcagcccaggtatcggaggaacatctatctt
tttatctactacttaatccagttctgtggccactcatggatatttacaaatatgacagtc
agattcttttcatttggaaaagattccatggttgacactttttatgccattggacttgtg
atgcgactttgccaatccgtctccctcttggagttgctgcacatatgtgttggcattgaa
tcgaaccatcttcttcccaggttcctgcagctcacagagagaataatcatcctctttgtg
gtgatcaccagtcaagaggaagtccaagggaaatacgtggtgtgtgttttattcttcttt
tggaatctattggatatggttaggtacacttacagcatgctttcagtcattggaatatcc
tacgccatcttgacgtggctcagtcaaacactatggatgcccgtttatcctttgtgtgtt
cttgctgaagcatttgccgtctatcagtcactgccttattttgaatcatttggcacttac
tccacaacgctgccctttgacttatccatctatttcccatacgtgctgaaaatatatctc
atgatgctctttataggtatgtattttacctacagtcatctttactccgaaagaagtgac
atgctcagagtcttccccattaaaaagaggaaaatctga

KEGG   Equus caballus (horse): 100068422
Entry
100068422         CDS       T01058                                 

Gene name
HACD1
Definition
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1 isoform X1
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100068422 (HACD1)
   01040 Biosynthesis of unsaturated fatty acids
    100068422 (HACD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100068422 (HACD1)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     100068422 (HACD1)
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100068422 (HACD1)
SSDB
Motif
Pfam: PTPLA DUF1180 DUF4383
Other DBs
NCBI-GeneID: 100068422
NCBI-ProteinID: XP_023487873
Ensembl: ENSECAG00000020223
VGNC: 18677
Position
29
AA seq 288 aa
MGRLTEAAAAGGGASAARSAGPPPTPLPLSATSPGTAATMASSEEDGSNGGASEAGEERE
AAGKRRRRGWVATAWLTFYNIAMTAGWLVLAIAMVRFYMEKGTHKGLYRSIQKTLKFFQT
FALLEIVHCLIGIVPTSVLVAGVQVSSRIFMVWLVTHSIKPIQNEESVVLFLVAWTVTEI
TRYSFYTFSLLDHLPYFIKWARYTFFIILYPVGVAGELLTIYAALPYVKKTGMFSIRLPN
KYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIVEKDD
NT seq 867 nt   +upstreamnt  +downstreamnt
atggggcgcctgaccgaggcggcggcagcgggcggcggcgcttcggcggcgcgctcggcc
gggcccccgcccactccccttcccctgtctgccacctcccccgggaccgcggccaccatg
gcgtccagcgaggaggacggcagcaacggcggcgcctcggaggccggcgaggagagggag
gccgccggcaagcggaggcgccgcggctgggtggccaccgcctggctcaccttctacaac
atcgccatgaccgcggggtggttggttctagctattgctatggtacgtttttatatggaa
aaaggaacacacaaaggtttatatagaagtattcagaagacacttaaatttttccagaca
tttgccttacttgagatagtccactgtttaattggaattgtgcctacttctgtgctcgtg
gctggggtccaagtgagttcaagaatctttatggtgtggctcgttactcacagtataaaa
ccaatccagaatgaggagagtgtggtgctctttctggtcgcgtggactgtgacagagatc
actcgctattccttctacacattcagtcttctcgaccacttgccatacttcattaaatgg
gccagatatactttttttatcatcttatatcctgtcggagttgctggtgaacttcttacg
atatacgctgccttaccatatgtgaagaaaacgggaatgttttcaataagacttcctaat
aaatacaatgtctcttttgactactattattttcttcttataaccatggcctcatatata
ccattgtttccacaactctattttcatatgttacgtcaaagaagaaaggtgcttcacgga
gaggtgattgtagaaaaggatgattaa

KEGG   Equus caballus (horse): 100070489
Entry
100070489         CDS       T01058                                 

Gene name
HACD2
Definition
(RefSeq) very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2
  KO
K10703  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00062  Fatty acid elongation
ecb01040  Biosynthesis of unsaturated fatty acids
ecb01100  Metabolic pathways
ecb01212  Fatty acid metabolism
Module
ecb_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100070489 (HACD2)
   01040 Biosynthesis of unsaturated fatty acids
    100070489 (HACD2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ecb01004]
    100070489 (HACD2)
Enzymes [BR:ecb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     100070489 (HACD2)
Lipid biosynthesis proteins [BR:ecb01004]
 Fatty acid synthase
  Component type
   100070489 (HACD2)
SSDB
Motif
Pfam: PTPLA
Other DBs
NCBI-GeneID: 100070489
NCBI-ProteinID: XP_023479410
Ensembl: ENSECAG00000008612
VGNC: 18678
Position
19
AA seq 254 aa
MAAAAATAATKGNGGGGCRAGGGEAGGARKKRGPGPLATAYLVIYNVVMTAGWLVIAVGL
VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEIIHCAVGIVPSSVVLTSFQVMSRVFLIWA
VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV
SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPLFPQLYFHMIHQR
RKVLSHTEEHKKFE
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcggcggccgcggcgactgcagcgacgaaggggaatgggggcggcgggtgccgggcc
gggggtggcgaagctggcggcgcgcggaagaagaggggccctgggcccttggccacggcg
tacctggtcatctacaatgtggtgatgacggccgggtggctcgttatagccgttggtctg
gtcagagcatacctggcgaagggcagctatcacagcctttattattccattgaaaagcct
ttgaaattcttccaaactggtgccttattggagattatacattgtgcagtaggaattgtt
ccatcttctgttgtcctgacttctttccaggtgatgtcaagagtttttctaatatgggca
gtaacgcatagcgtcaaagaggtgcagagtgaagacagtgtcctcctgtttgtcattgcc
tggaccatcacagaaattatccgttattccttttatacgttcagtctgttaaaccacctg
ccttacctcatcaaatgggccaggtacacgcttttcattgtgctgtaccccatgggagtg
tcgggagagctgctcaccatctacgctgccttgccctttgtcagacaggccggcctgtac
tccatcagtttacccaacaagtacaacttctcctttgactattacgcattcctcattctg
ataatgatctcctacattccactttttccccagttatacttccacatgatacaccagaga
agaaaggtcctttctcatactgaagaacacaagaaatttgaatag

DBGET integrated database retrieval system