KEGG   Escherichia coli O152 H28 SE11 (commensal): ECSE_2305
Entry
ECSE_2305         CDS       T00784                                 
Name
(GenBank) putative glycosyltransferase
  KO
K21363  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase [EC:2.4.1.305]
Organism
ecy  Escherichia coli O152:H28 SE11 (commensal)
Brite
KEGG Orthology (KO) [BR:ecy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ecy01005]
    ECSE_2305
Enzymes [BR:ecy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.305  UDP-Glc:alpha-D-GlcNAc-glucosaminyl-diphosphoundecaprenol beta-1,3-glucosyltransferase
     ECSE_2305
Lipopolysaccharide biosynthesis proteins [BR:ecy01005]
 O-antigen repeat unit
  ECSE_2305
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_tranf_2_4 Jacalin
Other DBs
NCBI-ProteinID: BAG77829
Position
complement(2356574..2357341)
AA seq 255 aa
MYNPLISVIMPAYNAENTIRKSVLSVLNQSYKNFELIICDDGSTDETKKIILTFSDARIK
FINNKYEKGAAGARNSAIDICSGEYVSFLDSDDIWASDKIEKQLSFMIKNDCDFSYGDYF
TFKDDDNTGLFLAPVKTSYEDLLKTCSIGCLTVMLHKKLLINQRFPSGYKEDYQLWLRIL
KDGIIAANYGSADSYYRLGKNTLSSNKIDELKKQWYVIRLQHVGYIKTVCYLLTYVYFGL
KKHCQAYRSGLGVKI
NT seq 768 nt   +upstreamnt  +downstreamnt
atgtataatcctcttatttctgtaataatgcctgcgtataatgctgaaaatacgattagg
aagtctgtactttctgtattaaaccaatcttataaaaattttgaactcataatatgtgat
gatggttctactgacgaaacaaagaaaataattcttactttttcagatgcacgtattaaa
tttataaacaataagtatgaaaaaggtgcagcaggggcgcgaaatagtgctattgatatc
tgtagtggtgagtatgttagttttcttgatagtgatgatatatgggcatctgataaaata
gaaaaacaactttcatttatgataaagaatgactgtgatttctcttatggggactacttt
acttttaaagatgatgataatacaggtctttttctggcacctgtaaaaaccagttatgaa
gatcttttgaaaacatgtagtataggttgtttgaccgtaatgcttcataagaaattgctc
attaatcaaagattcccatccggttataaagaagattaccagttatggctgagaattctc
aaagatggcataattgctgcaaattatggttcggcagactcttattacagattaggaaaa
aacactttgtcatcaaataaaattgatgaacttaaaaaacaatggtacgtaattaggtta
caacatgttggctatattaaaacagtctgctacttgcttacttatgtttattttggttta
aaaaaacattgtcaggcgtatagaagtggattaggggtgaagatataa

DBGET integrated database retrieval system