KEGG   Erythranthe guttata (spotted monkey flower): 105951625
Entry
105951625         CDS       T07346                                 

Name
(RefSeq) vetispiradiene synthase 3-like
  KO
K15804  5-epiaristolochene synthase [EC:4.2.3.61]
Organism
egt  Erythranthe guttata (spotted monkey flower)
Pathway
egt00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:egt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    105951625
Enzymes [BR:egt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.61  5-epiaristolochene synthase
     105951625
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth
Other DBs
NCBI-GeneID: 105951625
NCBI-ProteinID: XP_012830528
Position
Unknown
AA seq 540 aa
MLIQEGKTATIHEKLVLIDTLERLGVSYHFHREIENLLHQIQDYYLKYLEKGPETFPAGI
MEFLFPKHIENVEARTEIYNHRSILKVYIAGVFDKFKGEDNKFKETLKSDAKGLLSLYEA
AHLRIRGEEILEEAAAFATYHLNLMLDDDDQQLLLEFPLLEEQVKRALQNPLHRGVPRIE
TRRFISFYEKDESRSELLLRLAKLDFNYLQNIYKKELSQLSRWWNELNLMPKLPYARSRV
VESYIWATAFCFEPQYSDARLAATKTLQMLTLIDDTYDNYSTLEEADLFTHIIQRYAEWW
NIDEIDDYDQIPDHMKIICEFTFSMYEEYEREAAKQGKSFAAPYAKESVKHLCRAYNKGL
RWCMGGENSNMPRFEDYSVNTVITSCLYVFCSWMMPGMRHVSSKETVDWLMSDPKIIAAS
AKVCRFLDDLGSYQRERKEGRMLTGVDFYMKEHGISVEETADKFVELADEAWKDLNEEWI
VNSGKTGRGYYRNIPKDMVEMVLNYARVAELNYRSLQDGFTKPEILAPHIATLFVDPIIM
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgctcattcaagaaggaaaaacagctactattcatgagaaactagtgttgatcgacaca
ctcgagcgtttgggagtgtcttatcacttccatcgagaaatcgaaaacctactccatcaa
atccaagactactatttaaagtatttagaaaaaggccccgaaacgtttccggcaggtata
atggagtttctgtttccgaaacatatcgaaaacgtggaagcacgtacagaaatatacaat
catcgatcaatattgaaagtatatattgcaggtgttttcgacaagtttaagggcgaagac
aacaaattcaaagagaccctaaaaagtgatgctaagggattgttgagcttgtacgaagct
gcacacttgagaattcgtggcgaagaaatcctggaagaggctgcggccttcgcaacatat
catctcaatcttatgttagatgatgatgatcaacaattattattagagtttccattactt
gaggaacaagtgaagcgggccctacagaacccacttcatagaggcgttccaagaatagaa
acccgtcgttttatttcattttacgaaaaagatgaatcgaggagtgaactacttctccga
ctagccaaactggatttcaattatttgcagaatatctacaagaaagagctctcccaactc
tccaggtggtggaacgaattgaacctgatgccaaaactgccgtacgcgagaagtagagtg
gtggaatcctacatttgggcgacggctttttgtttcgagcctcagtactccgatgctcga
ttagcagctactaaaaccttgcaaatgcttacacttatcgatgatacatacgacaattat
tccacgcttgaagaagccgaccttttcacccacattatccaaaggtatgccgaatggtgg
aatattgatgaaattgacgactacgatcaaatcccggatcatatgaaaatcatttgcgag
tttacttttagcatgtacgaagagtacgaacgtgaagcagccaaacaaggaaaatctttt
gcagctccttatgccaaagaaagtgtgaaacacttatgtagggcttacaataaagggcta
aggtggtgcatgggaggagaaaatagtaatatgccaagatttgaagattacagtgtgaat
acagtaatcacaagctgcctgtatgttttctgctcatggatgatgccgggtatgagacac
gtgtcgtcaaaagaaaccgttgattggctgatgagcgaccctaagattattgcagcttct
gctaaggtgtgccgctttttggacgacttgggcagctatcaacgcgaacgcaaggaggga
cgaatgctgacaggggtagatttttacatgaaagagcacggtatctcggtagaagagacc
gcggataagtttgtggaactagccgacgaggcatggaaggatttgaacgaagaatggatc
gtaaatagtggtaaaacaggccggggttattatcgaaatataccaaaggatatggtggag
atggttctcaactacgctcgcgtagcggagctcaactacaggagtctccaagatggcttt
acaaaacctgaaatcttggcaccccacattgctacattgtttgttgatccaattatcatg
tga

DBGET integrated database retrieval system