KEGG   Erythranthe guttata (spotted monkey flower): 105959240
Entry
105959240         CDS       T07346                                 

Name
(RefSeq) ferruginol synthase-like
  KO
K20513  ferruginol synthase [EC:1.14.14.175]
Organism
egt  Erythranthe guttata (spotted monkey flower)
Pathway
egt00904  Diterpenoid biosynthesis
egt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    105959240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:egt00199]
    105959240
Enzymes [BR:egt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.175  ferruginol synthase
     105959240
Cytochrome P450 [BR:egt00199]
 Cytochrome P450, plant type
  CYP76 family
   105959240
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105959240
NCBI-ProteinID: XP_012838752
UniProt: A0A022RBN6
Position
Unknown
AA seq 533 aa
MNKCCIFVCVQLVYIEFECSACVCVCERDEMGFITLLIILFTVLWAAVLVFRSNSRRRPS
SAKLPPGPYRFPIVGNIPQLGLNPHQSFANLSKTYGPLMSLHLGSVYTVVVSSPEIAREV
LQKHDQVFSGRIIGAAAQVHDHHNISIAYLPAGIEWRKKRKICREHMFSTHRLDESQALR
REKLQKLCDYVSNCCGGGGGGGGDGRAVNIGEAAFITSLNLMSATLFSVDFTDFDSDATQ
DLKETIEGVAKILGTPNLADFFPIFKRFDPQGIQKKAEFYFGKLLGLFEDIINQRLESRR
TVGSSRKNDLLETLFDLSQGTDYDLTCKDIKHLLVDLFVAGTDTTSSTVEWAMTELLLNP
EKMANAKNELTTLIGKNKQVQESDISKLPYLRALVKETFRYHPGGPLLIPHKAEDDVEIN
GYTIPKDTQILVNVWAIGRDSSIWSNPDSFEPERFLDSKVDFKGQDFELIPFGSGRRMCP
GLPLVDRMLHLTVASLIHNFDWKLEAGVKLDTEEKFGLSLHKAVPLEAIPTKV
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgaataaatgttgtatatttgtatgcgttcaattagtatatatagaatttgagtgcagt
gcgtgtgtgtgtgtgtgtgagagagacgaaatggggtttataactcttttgattattcta
tttaccgtgctttgggcggcggttcttgtattccggtcaaattcacggcggcggccgagc
tcagccaagcttccaccaggaccttacaggtttccgatcgtcggcaatattccccagctc
ggtctgaatcctcaccaatcgttcgccaacctctccaaaacttacggccctttaatgtct
ctccatctcggaagtgtttacacagtcgtcgtgtcgtcgccggaaatcgcaagagaagta
ctgcagaagcacgaccaggttttctccggccgaatcatcggcgccgccgcccaagtccac
gaccaccacaacatctcgatcgcctacctgccagccggaatcgagtggcggaagaaacgc
aaaatatgccgagaacacatgttctccacccatcgcctggacgaaagccaagcactccgg
cgggagaagttgcagaaactgtgcgactacgtgagcaattgttgcggcggcggcggagga
ggaggaggagatggccgagccgtgaacatcggcgaggcggcgttcataacctcgctgaat
ctaatgtcggccacacttttctcggttgatttcaccgatttcgattcagatgctacacag
gatttaaaggagacaattgaaggtgtggcgaagattttaggtaccccaaatctcgccgat
ttcttcccaattttcaaacggttcgatccacaaggtattcagaagaaggctgaattttac
tttgggaaactgcttgggttgtttgaagacataatcaatcaaagattggaatcaaggcgg
accgttggatcttcaaggaaaaatgatctgctagaaacactatttgatctcagccaagga
accgactacgatttgacttgcaaagatatcaaacatctacttgtggacttattcgttgca
ggaacagacacaacatcgagcacggttgaatgggcgatgacggaattacttctaaacccc
gaaaagatggccaatgccaaaaatgagctaactactttgattggcaaaaacaaacaagtc
caagaatccgacatatcgaaactcccatatttacgagctctggttaaagaaacatttcgg
taccacccaggggggccgcttttaataccgcacaaggcagaagatgatgttgaaatcaac
ggctatacgatccccaaagacacgcagatacttgttaatgtttgggctattggtagagat
tcgagcatttggtcgaatccagattcatttgagcccgaacgatttctggacagcaaagtg
gacttcaagggacaagattttgagcttattccgtttgggtcggggagaaggatgtgcccg
ggtttgcctctggttgatcgaatgctgcatcttacggtggcttctttgattcataacttt
gattggaaactcgaggcgggggtgaaactggatacggaggagaagtttggactttcgctg
cataaggcagttcccctcgaggctattccaaccaaggtgtga

DBGET integrated database retrieval system