KEGG   Entamoeba histolytica: EHI_164430
Entry
EHI_164430        CDS       T00238                                 

Gene name
467.t00004
Definition
(RefSeq) actinin-like protein
  KO
K13978  actinin-like protein
Organism
ehi  Entamoeba histolytica
Pathway
ehi05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    EHI_164430 (467.t00004)
SSDB
Motif
Pfam: EF-hand_1 CH EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 ARGLU CAMSAP_CH DUF4670 DDHD
Other DBs
NCBI-GeneID: 3402620
NCBI-ProteinID: XP_648375
UniProt: C4M1S5
AA seq 458 aa
MKEEKLNTSVSAENIVDGNRTYILGMVWTMILKYKINANQQKNVNAKEEVVENNALLDWV
NSFGLNVSNFSSDWKDGVALVKLTEAVSAGQIKFEQFSGLDNTQMVIDCQKLAYEQFKIP
ILMDVKDLVCERPDPKSIMTYVSVYKERYEQLLVEKEQKEEQERIAREEQERKQKEEQER
LAREEQERLAREEQERLAREEQERLAREEQERKQKEEQERLAREEQERKQREEQERLNQQ
QPTSQQLTFFSVQAAADAWILQNIQAAYAQDPTIQFQWWYPLVQNLSANDFRELQDWFKK
IDKDKSGTLELDELLKAKWPKDMKMNNETIKRLMLIFDADNNGSIGFYEFIALYNWVKLC
VATFKHFDVDQSGSLDITELQVALPQLGFNLNKQSCDALIRANKNLIGKKKLNQVQFICA
TSYLAQCRTIYQLTFDTHRDQLDPVEFDKFINLVLGLI
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgaaggaagagaaacttaacacatcagtatcagctgaaaatattgttgatgggaataga
acttatattcttggtatggtatggactatgattcttaaatataaaattaatgccaaccaa
caaaagaatgttaatgcaaaagaagaagtagtagaaaataatgcacttttggattgggtc
aattcttttggtctgaatgtatctaatttctcaagtgactggaaagatggggttgctctt
gttaaattaacagaagcagtttctgctggtcaaattaagtttgaacaatttagtggatta
gacaatactcagatggttattgactgccaaaaacttgcatacgaacaattcaaaattcca
attttgatggatgtaaaagatttggtatgtgaacgtccagatcctaagtctattatgacg
tatgtttcagtttataaagaaaggtatgaacagttacttgttgaaaaagaacaaaaagaa
gagcaagagagaatagctagagaagagcaagagagaaaacaaaaagaagagcaagaaagg
ttggctagagaagaacaagaaaggttggctagagaagaacaagaaaggttggctagagaa
gaacaagaaaggttggctagagaagagcaagagagaaaacaaaaagaagagcaagaaagg
ttggctagagaagaacaagaaagaaaacaaagagaagagcaagaaagattaaaccaacaa
caaccaactagtcaacaattaacatttttctcagttcaagcagcagcagatgcctggatc
ttacaaaatatacaagctgcctatgcacaagacccaacgattcaattccaatggtggtat
ccattagttcaaaaccttagtgcaaatgactttagagaacttcaagattggtttaaaaaa
atagataaagataaatctggaacgttagaattagatgaattattaaaggctaaatggcct
aaagatatgaaaatgaataatgagactatcaaaagattaatgttaatatttgatgctgac
aataatggatcgattggattttatgaatttattgctctttacaattgggtaaaattatgt
gttgcaacatttaaacattttgatgttgatcaaagtggttcattagatattacagaactt
caagtagcacttcctcaattaggattcaatttaaataaacaaagttgtgatgcattaatt
agagcaaacaaaaatttaatagggaaaaagaaattaaaccaagttcaatttatttgtgct
acttcttatcttgcacaatgtcgaacaatttaccaattaacttttgacactcatagggat
caattagatccagtagaatttgataagtttatcaacttagttcttggacttatttga

DBGET integrated database retrieval system