KEGG   Entamoeba histolytica: EHI_164440
Entry
EHI_164440        CDS       T00238                                 

Gene name
54.t00013
Definition
(RefSeq) actinin-like protein
  KO
K13978  actinin-like protein
Organism
ehi  Entamoeba histolytica
Pathway
ehi05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:ehi00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    EHI_164440 (54.t00013)
SSDB
Motif
Pfam: EF-hand_1 CH EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 CAMSAP_CH
Other DBs
NCBI-GeneID: 3408742
NCBI-ProteinID: XP_654429
UniProt: C4M1S6
AA seq 522 aa
MKEEKLNTSVSAENIVDGNRTYILGMVWTMILKYKINANQQKNVNAKEEVVENNALLDWV
NSFGLNVSNFSSDWKDGVALVKLTEAVSAGQIKFEQFSGLDNTQMVIDCQKLAYEQFKIP
ILMDVKDLVCERPDPKSIMTYVSVYKERYEQLLVEKEQKEEQERIAREEQERKQKEEQER
LAREEQERLAREEQERLAREEQERLAREEQERKQKEEQERLAREEQERLAREEQERLARE
EQERKQKEEQERLAREEQERLAREEQERLAREEQERKQKEEQERLAREEQERKQREEQER
LNQQQPTSQQLTFFSVQAAADAWILQNIQAAYAQDPTIQFQWWYPLVQNLSANDFRELQD
WFKKIDKDKSGTLELDELLKAKWPKDMKMNNETIKRLMLIFDADNNGSIGFYEFIALYNW
VKLCVATFKHFDVDQSGSLDITELQVALPQLGFNLNKQSCDALIRANKNLIGKKKLNQVQ
FICATSYLAQCRTIYQLTFDTHRDQLDPVEFDKFINLVLGLI
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgaaggaagagaaacttaacacatcagtatcagctgaaaatattgttgatgggaataga
acttatattcttggtatggtatggactatgattcttaaatataaaattaatgccaaccaa
caaaagaatgttaatgcaaaagaagaggtagtagaaaataatgcacttttggattgggtc
aattcttttggtctgaatgtatctaatttctcaagtgactggaaagatggggttgctctt
gttaaattaacagaagcagtttctgctggtcaaattaaatttgaacaatttagtggatta
gacaatactcagatggttattgactgccaaaaacttgcatacgaacaattcaaaattcca
attttgatggatgtaaaagatttggtatgtgaacgtccagatcctaagtctattatgacg
tatgtttcagtttataaagaaaggtatgaacagttacttgttgaaaaagaacaaaaagaa
gagcaagagagaatagctagagaagagcaagagagaaaacaaaaagaagagcaagaaagg
ttggctagagaagaacaagaaaggttggctagagaagaacaagaaaggttggctagagaa
gaacaagaaaggttggctagagaagagcaagagagaaaacaaaaagaagagcaagaaagg
ttggctagagaagaacaagaaaggttggctagagaagaacaagaaaggttggctagagaa
gagcaagagagaaaacaaaaagaagagcaagaaaggttggctagagaagaacaagaaagg
ttggctagagaagaacaagaaaggttggctagagaagaacaagagagaaaacaaaaagaa
gagcaagaaaggttggctagagaagaacaagaaagaaaacaaagagaagagcaagaaaga
ttaaaccaacaacaaccaactagtcaacaattaacatttttctcagttcaagcagcagca
gatgcctggatcttacaaaatatacaagctgcctatgcacaagacccaacgattcaattc
caatggtggtatccattagttcaaaaccttagtgcaaatgactttagagaacttcaagat
tggtttaaaaaaatagataaagataaatctggaacgttagaattagatgaattattaaag
gctaaatggcctaaagatatgaaaatgaataatgagactatcaaaagattaatgttaata
tttgatgctgacaataatggatcgattggattttatgaatttattgctctttacaattgg
gtaaaattatgtgttgcaacatttaaacattttgatgttgatcaaagtggttcattagat
attacagaacttcaagtagcacttcctcaattaggattcaatttaaataaacaaagttgt
gatgcattaattagagcaaacaaaaatttaatagggaaaaagaaattaaaccaagttcaa
tttatttgtgctacttcttatcttgcacaatgtcgaacaatttaccaattaacttttgac
actcatagggatcaattagatccagtagaatttgataagtttatcaacttagttcttgga
cttatttga

DBGET integrated database retrieval system