KEGG   Entamoeba invadens: EIN_059480
Entry
EIN_059480        CDS       T04133                                 

Definition
(RefSeq) grainin, putative
  KO
K13978  actinin-like protein
Organism
eiv  Entamoeba invadens
Pathway
eiv05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:eiv00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    EIN_059480
SSDB
Motif
Pfam: CH EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5
Other DBs
NCBI-GeneID: 14892237
NCBI-ProteinID: XP_004260234
Position
Unknown
AA seq 668 aa
MSDAAAITEWEQSQIRTYTHWVNYNLDEKHQITDITKELGDSDVLISLIEKLAGKTFYSH
KPAVAKSKIFKINNCTKAIEVMHKEGVNADISAENIVDGEQKYILGMVWMMILKYKINNV
PKSDESSGKQAAAPVDAALLDWVNSLSDVKVTNFSSDWSSGEAFVALTGAVSFGEIDVNE
FDGLSPHDKIEKCQQAAQEKLNIPVLMDVQDLACEKPDPKSVMTYISVYKEKYPALQQAH
EDKIKQQQENEEAEKKRLADEEEERKEAERFAAEQAEKARIAAEEAERKRIAEEEAEKAR
IAAEEAEKARLAAEEAERLRKEKEEAERLAAEEAERARIQAEEAEKARLAAEELERQRQA
AQEESERQRIAAEQAEQARIAAEQAEKARIAAEEAEKARLAAEEAEKQRIAAEQAERDRI
AAQEAERQRMIAEEQERQRLAAIEAERLARERSSRPQFFAIQEAVDQWVAETVKAAVAAN
PRLQFQWWFPLVLTLTGNDYRELQAWFKKIDKDKSGTLELDELLKAKWPKDMKINSETTK
RLMMIFDAGCTGSIGFFEFVALYNWVKLCFATFNRFDKDNSDSLSLDEAQEALPYLGFSL
NKKNTNTLIKLNKNLFGKKKLNKVQFCCAVSYLAQCRTIYQLTFDTPAVDLDKVEFDKFV
NLVLSLAD
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgtccgacgccgcagcgatcactgaatgggaacagtctcaaatccgaacatatactcat
tgggtcaattacaacttagatgaaaaacaccaaatcacagatatcaccaaagagttgggt
gacagtgatgttctcatttctcttattgaaaaattggcagggaagaccttttattcccac
aaaccagccgttgctaagtcgaagatatttaagataaacaattgcaccaaagctatagaa
gtcatgcataaagaaggagtaaatgcagacatctctgctgagaacatagtcgacggtgaa
cagaagtacattcttggcatggtctggatgatgattctgaaatacaaaattaacaatgtt
ccaaagagtgacgagtcttctgggaaacaagcagcagcacccgttgatgctgcacttctg
gattgggttaattcactctctgatgttaaagtgacaaacttttccagtgactggagcagt
ggagaggcttttgtcgctcttactggagcagtctcgtttggagagattgatgtcaatgaa
ttcgatggactttctccacacgataaaatcgagaagtgtcaacaagctgctcaagagaaa
ttgaacatccctgttcttatggatgtacaagacttggcatgtgagaaaccagaccccaag
agcgttatgacatatatctccgtctacaaagaaaagtatccagctttacaacaagcccac
gaagataaaattaaacaacaacaagaaaacgaagaagcagagaaaaaacgacttgcagat
gaagaagaagagcgaaaagaggccgagcgtttcgccgcagaacaggctgagaaggcgaga
atagctgcagaggaggctgaaagaaagagaattgctgaagaagaagcagaaaaagccaga
attgctgcagaggaggccgagaaagcaagattggcggcggaagaagctgagcggttaaga
aaggagaaggaagaagctgaaagactggcagcagaagaagccgagagagctagaatacaa
gccgaagaggcagaaaaggcaagactcgccgctgaagaactcgagagacaacgacaggca
gcacaagaagaatctgaacgacaaagaatcgccgcggaacaagctgaacaggcccgaatt
gctgctgagcaagcagagaaggcgaggatcgccgcagaagaagctgaaaaggcaagattg
gctgctgaggaggctgaaaaacaacgcattgcagcagaacaggccgagagagatcgaatt
gctgctcaagaagccgaacgtcaaagaatgattgccgaagaacaagaaagacaacgtctt
gccgctatcgaagccgaaaggcttgctagagaaagatcatcacgtccacagttcttcgct
attcaagaagcagtcgaccaatgggttgcagagactgtaaaagctgctgtggctgccaat
ccaagattacagttccagtggtggttcccgttggttttgacattgactggtaatgactac
agagagttgcaagcatggtttaagaagatagataaggacaaaagtgggacattggaattg
gacgaattgttgaaagcgaaatggccaaaagatatgaaaatcaactccgagaccaccaag
agactgatgatgatctttgatgctgggtgcactggatccattggtttctttgagtttgta
gcattgtacaactgggttaaactctgctttgccacatttaataggtttgacaaagacaac
agtgattcgttgagtcttgacgaggcacaagaggctctcccatacttgggattctcattg
aataaaaagaacacaaacactctcatcaagctgaacaagaacttgtttggaaagaaaaaa
ctcaacaaggtgcagttctgttgtgctgtttcatatcttgcacaatgccgcactatctat
caactcacttttgatactccagctgttgacttagataaggttgagtttgacaaatttgtc
aaccttgttttgtcactagcagactaa

DBGET integrated database retrieval system