KEGG   Ensifer mexicanus: FKV68_32690
Entry
FKV68_32690       CDS       T06706                                 

Name
(GenBank) LysE family translocator
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
emx  Ensifer mexicanus
Brite
KEGG Orthology (KO) [BR:emx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:emx02000]
    FKV68_32690
Transporters [BR:emx02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   FKV68_32690
SSDB
Motif
Pfam: LysE LptF_LptG TerC TMEM43
Other DBs
NCBI-ProteinID: QLL66309
UniProt: A0A859R421
Position
pEmeITTGR7c:1737710..1738324
AA seq 204 aa
MLFGKGLLLGLAIAAPVGPIGALCISRTLTRGFWAGVAGGLGTALADAAYAMLAAVGFAA
FAAALSAIATPLGLVGGLFMIWLGWRGLAPKPVATAAEIDARDLIHTTTATFFLTIANPT
TILSFAAIFAGLGLSTVGQGIKGAIVVSGVFLGSLAWWFFLSGGVALAKRRLPDSFAAWV
SRISGLLLIAFGITALASSATRFV
NT seq 615 nt   +upstreamnt  +downstreamnt
ctgcttttcggaaaaggcctcctgctcggcctcgccattgccgccccggtcgggccgatc
ggcgcgctttgcatcagccgtacgctgacgcgcggcttttgggccggcgtcgcgggcggc
cttggaaccgcgctcgccgacgcggcctacgcgatgctcgcggcggtcggctttgcggca
ttcgctgctgcgctttccgcaatcgcgacaccgctcggcctggtgggaggcctgttcatg
atatggctcggctggcgcggactggcgccgaaaccggttgctacggccgccgagatcgac
gcgcgcgatctcattcatacgacgaccgcgaccttcttcctgacgatcgccaaccccacg
acgatcctgtccttcgccgccatcttcgccgggctcgggctttcgacggtgggccaaggg
ataaagggcgcgattgtcgtctcgggcgtctttctcggttcgctcgcctggtggttcttc
ttgagcggcggcgtcgcgctcgccaagagacggctcccggatagtttcgccgcttgggtg
tcgcgcatttccgggcttctgctgatcgcattcggcataaccgcgctcgcatcgagcgcg
acacggtttgtctga

DBGET integrated database retrieval system