Emticicia sp. 21SJ11W-3: MB380_20400 Help Entry MB380_20400       CDS       T09449                                  Name (GenBank) NUDIX domain-containing protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism emz  Emticicia sp. 21SJ11W-3 Brite KEGG Orthology (KO) [BR:emz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:emz03400]     MB380_20400 Enzymes [BR:emz01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      MB380_20400 DNA repair and recombination proteins [BR:emz03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     MB380_20400  Prokaryotic type     MB380_20400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX C3_CUB2 Motif Other DBs NCBI-ProteinID:  UTA67932 Position 4819495..4819893 Genome browser AA seq 132 aa AA seqDB search MKKIDKLAWIRVENRKILSTRSKGKDVFYFPGGKRELDESDEAALLREIQEELTVDLLPD SLRFFGKFEAQAHGHAEGTLVIMTCYEADYKGTLTPAAEIDEIAWLGYADRLRSSAVDQL IFRYLKERDLID NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagattgataaacttgcctggatacgcgtagaaaacagaaagatattaagcacc agaagcaaagggaaagatgtcttttattttccgggcggtaaaagagagcttgacgaaagc gatgaagccgcattgctgagagaaatacaagaagaactaaccgttgatttgctgccggat tctttacgtttcttcggaaaatttgaggcacaggcacacggccatgcagaaggcacattg gttataatgacctgctacgaagcagattataaaggaaccctgacccccgccgctgaaatt gatgaaattgcctggcttggttacgctgacaggctcagaagttctgctgttgaccagctc attttcagatacctgaaagagcgtgacttaatagattaa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (2) Pfam (2) All databases (3) Download RDF

DBGET integrated database retrieval system