KEGG   Eremothecium cymbalariae: Ecym_4761
Entry
Ecym_4761         CDS       T02237                                 

Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
erc  Eremothecium cymbalariae
Pathway
erc03440  Homologous recombination
erc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:erc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Ecym_4761
   03450 Non-homologous end-joining
    Ecym_4761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:erc03400]
    Ecym_4761
DNA repair and recombination proteins [BR:erc03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     Ecym_4761
   NHEJ (non-homologous end-joining)
    MRX complex
     Ecym_4761
SSDB
Motif
Pfam: FHA Yop-YscD_cpl BRCT
Other DBs
NCBI-GeneID: 11470249
NCBI-ProteinID: XP_003646590
UniProt: G8JSQ1
Position
4:1479649..1482045
AA seq 798 aa
MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVIDERGVSRTHLQLKANRNI
IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLEI
NYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLKGI
SSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVGGG
TVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGFKQHD
TRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATSGLNLN
TEGPPAKKRRINSVKPLDSLSFFAGGSIERSTRVERNSSEKQTVQPAEHNKIAETSIASI
ELLPTKSGIKEITDVVPETENEPEPMVSPKKRSPAKNESLADMRAGDNHVSIKTTLEVEK
SAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESKDSTLSTQSHSSIVNAIKEIKEREVSR
IKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSRHMKTETNKRHHVRRNFKRFVK
VWPAYLNKAICQDPMGAQRYSNRQCVPLKVYEPMNKNELTDDQLVDENSSEEKNDIMNET
FTSDPLDHNIQMASKSIPRHHDSIYQSKYEQVLSNPELEFSFSTIRNSNSSESVTNNPGN
SLFVVEDESDDNTAVTYHNLSATSATRTEGSDVSIQARTSRIVTRPKNNATVLKYIGNEE
DDEDDEDEAPRFAFRRTR
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgtggatatttaaatgccaatatcaaaatcaaaaagatcctgatactttaaatgcgata
tccagtgttataaagcccgataagaactacatagttgggagagccagcaaaagttcgcta
gtaattgatgaaaggggtgtctctagaactcacttgcagctgaaagccaatagaaatatc
attgaaatcacattattaggggcccagttgaagattggtcacaagacaatagaaaaaggc
atttcctgtgagtttcatccgaaacaaagcccacttcgccttgaagtgggttcgcatagc
attgaatgtaagttattatggactcagtgggagttcaaggtgcctagtgatttagagata
aactatatcgctctaactaagatgtttgtccaattaggtattaagatagtcttttcatta
tctaaagagacatcgcatcaaattgttagatctcgacaaggacaaaaggattatgataaa
tatctgtttgcgttggttaaaggcctccctttagttgaagttgggtttcttaaaggaatt
tcgtcattattgaattcagatactctaaaatttgaatcgaaagtcaaggaattggagaga
gaattctctattttcccagaattcaatcccataccaaatcctttaaaagggttgtacttt
atagtgcctgaaaaagatgagtttgacattctaaagtacacaattgaagtaggtggagga
accgtttataattgtattacatttgaagatttcgttaaagttacgtctacaattccatca
tcgaaggtcattctaataaagtgttcaaacaacatctctcccgctattgatacgcaaaag
ccaactgaccataatattctgctagaaaaggcacattctattggttttaaacaacatgat
accagggaattaacgatcgctgttttaaacaataactttgaagaaactttgatagactct
tcgatatcagataagcgtctaatctcctgtaattcgaatgacaaactcaaaacaacgtca
acttcactggaagacggattaaaagttaatgtttcagctacttctggattaaatctaaat
acggagggaccacctgccaaaaaacgtaggataaatagtgttaaaccgttggatagtctg
tccttttttgcgggtggtagtatagaaagaagcaccagagtagaaagaaattcaagtgag
aaacaaactgtacaacctgcagaacacaataagattgcagaaacatcaattgcttctata
gaattattaccaacaaaatctggaattaaagaaatcacggacgtcgtgcctgagactgaa
aatgagccagaacctatggttagccccaagaagaggagtcctgctaaaaatgagtcgttg
gcagatatgagggcgggagataatcacgtcagtattaaaacaacattggaagtggaaaaa
agtgccgaaccatctcataaaaagctaaaagtcgaaggaatatttgatgaaaaagttgaa
atgtccaatgagcaaaagtatcatttaaatgcagaatctaaagattcaactttatcaact
caatcccacagttccatagtaaatgctataaaggagataaaagaacgtgaagtgagccgc
attaagaccactatagtggaaatcggacctgatgaacttacggaagaagcaatttgcaaa
ctgagcacactagccgttgtggagagtgtggatatgctacggaaaacacaatctagacat
atgaaaacggaaacgaataaacgtcaccatgttcgcagaaactttaaaaggtttgtaaaa
gtatggccggcatacctgaataaagccatatgccaagaccccatgggtgcccaaaggtat
tccaataggcaatgtgtaccattgaaagtttacgaacctatgaataaaaacgaactaacc
gatgatcagttggtagatgaaaattctagtgaagaaaaaaacgacataatgaatgaaacc
tttacgagcgacccattggatcataacatacaaatggcctctaaatcaataccaagacac
cacgacagcatataccaatcaaaatatgaacaagtattatcaaatcctgaactggaattc
agcttcagcactattagaaactctaactcaagtgagtctgtcacaaacaatcctggaaac
agtttgttcgttgtcgaagatgaaagcgacgacaatactgcagtgacatatcataattta
agtgcaacttctgctaccagaactgagggttccgatgtaagcattcaagcacgaacttca
cgtattgttactcgtcccaaaaacaacgctaccgttttgaaatatattgggaatgaggag
gatgacgaagatgacgaagatgaagctccgagattcgcattcagaagaacaagatag

DBGET integrated database retrieval system