KEGG   Aurantiacibacter atlanticus: CP97_14145
Entry
CP97_14145        CDS       T03997                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
ery  Aurantiacibacter atlanticus
Pathway
ery00626  Naphthalene degradation
ery01100  Metabolic pathways
ery01120  Microbial metabolism in diverse environments
ery01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ery00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CP97_14145
Enzymes [BR:ery01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     CP97_14145
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: AKQ42929
UniProt: A0A0H4VIY8
Position
complement(2898021..2898614)
AA seq 197 aa
MTRTIDFYFDFISPFSYLAQLKLPEIARRNNCEVNYWPMDIPEAKIAAGNYGPSNREVVP
KIKVMMADLERWAKHYEVPLSFPESFDCGDWNCAVLFARDEGKAEAFVTDAYRRIWGEGI
DPRDRKELRACAETAGLDPDKLVDFVDSTIGQNEYRKARAQAIQRGVFGAPLMFVNDQIF
WGNDRLDFLEEYLRSRQ
NT seq 594 nt   +upstreamnt  +downstreamnt
atgacccgtactattgatttctatttcgacttcatcagtccctttagctacctcgcgcag
ctgaagcttccagagattgcccggcgcaataattgcgaagtgaactattggccgatggat
attccggaagcgaaaatcgcagcgggaaattatggcccatccaaccgtgaggttgttccg
aagatcaaggtgatgatggcggatctggaacgatgggcaaagcactacgaagtgcccctg
tcttttcctgaaagcttcgattgcggcgactggaactgcgctgttctatttgcccgtgat
gaagggaaggcggaggcgttcgtaacagatgcctatcgacgcatctggggcgaggggatt
gatccacgcgatcgtaaagagctgcgtgcatgcgccgaaactgcgggccttgatccagac
aagctggttgattttgtcgattctacgatcgggcagaatgaatatcggaaggcgagagca
caggccattcagcgcggtgttttcggtgcccccctgatgtttgtgaatgaccaaatcttc
tggggcaatgatcgactggatttcttggaggaatacttgcgcagtcgacaataa

DBGET integrated database retrieval system