KEGG   Eutrema salsugineum: EUTSA_v10013695mg
Entry
EUTSA_v10013695mg CDS       T02985                                 

Name
(RefSeq) hypothetical protein
  KO
K21360  3-isopropylmalate/methylthioalkylmalate dehydrogenase [EC:1.1.1.85 1.1.1.-]
Organism
eus  Eutrema salsugineum
Pathway
eus00290  Valine, leucine and isoleucine biosynthesis
eus00966  Glucosinolate biosynthesis
eus01100  Metabolic pathways
eus01110  Biosynthesis of secondary metabolites
eus01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:eus00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    EUTSA_v10013695mg
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    EUTSA_v10013695mg
Enzymes [BR:eus01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     EUTSA_v10013695mg
    1.1.1.-  
     EUTSA_v10013695mg
SSDB
Motif
Pfam: Iso_dh Fibrillarin
Other DBs
NCBI-GeneID: 18017182
NCBI-ProteinID: XP_006399931
UniProt: V4LCE8
Position
Unknown
AA seq 408 aa
MTAVLQTNIRLSLINIVPGKCRSLADQSRAPCRIRCSAASPGEKRFNIALLPGDGIGPEV
ISVAKNVLQQAGSLEGLEFNFQEMPVGGAALDLVGVPLPEETWSAAKQSDAILLGAIGGY
KWDNNERHQRPELALIYLRRDLKVFANLRPATVLPQLVDSSTLKREVAEGVDMMIVRELT
GGIYFGEPRGITTNDNGEEVGFNTEIYAVHEIDRIARVAFETARKRRGKLCSVDKANVLD
ASVLWRKRVTAIASEYPDVELSHMYVDNAAMQLIRDPKQFDTIVTNNIFGDILSDEASMI
TGSIGMLPSASLGVSGPGLFEPIHGSAPDIAGQDKANPLATILSAAMLLKYGLGEEKAAK
RIEDAVLDALNKGFRTGDIYSPGNKLVGCKEMGEEVLKSVDSKVTVTV
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgacggcggttttgcagacgaacatccggctgagtctgatcaacatcgtcccgggaaaa
tgcagatctcttgccgatcagtctcgcgcgccgtgtcgaataaggtgctccgccgcttca
ccgggggaaaaacggttcaacatcgctctccttcccggcgacgggatcggtccggaagtc
atctccgttgccaagaatgtgcttcagcaagctggatctctcgaaggactggaatttaat
ttccaggagatgcctgtcggaggagcagccttggatttggtcggagtgcccttgccggag
gaaacctggtcggctgcaaaacaatctgatgccatacttcttggagctatcggagggtac
aaatgggacaacaatgagagacatcagaggcctgaattggctctgatttaccttcgcaga
gatctcaaagtctttgcaaatttgagacctgctacagttttgccacagctagttgattcg
tccaccttgaagagagaagtggcagaaggtgttgatatgatgattgtaagggagcttaca
ggaggcatttactttggagagccaaggggcattacgaccaacgacaatggcgaagaagtc
gggtttaatacagagatctacgctgttcacgagattgacagaattgctcgtgttgctttc
gagactgctaggaaacggcgtggcaagctttgttctgttgataaggccaacgtgttggat
gcatcagtactgtggaggaaaagagtaacagcgatagcctctgaatatccagatgttgaa
ctatcacatatgtatgtcgacaatgctgcaatgcagcttattcgtgacccgaaacagttt
gacacaatcgtgaccaataacatttttggtgatatattatctgatgaggcctcaatgatc
actggaagcattgggatgcttccatctgctagtctcggtgtatcgggacctggactcttt
gagcctatacatggttctgcaccagatatagctggtcaggacaaggcaaacccattggcc
accattctcagcgctgcgatgcttttgaaatatgggcttggagaagaaaaggctgcaaaa
aggatcgaagacgcggtcttggatgctctcaacaaagggtttagaaccggagacatctac
tcccccggaaataaactggtgggatgcaaggagatgggtgaggaggtgcttaaatcagtg
gactccaaagtcacagttactgtttaa

DBGET integrated database retrieval system